Mouse Anti-Medaka TRH Antibody (MO-AB-01804R)


Cat: MO-AB-01804R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityMedaka (Oryzias latipes)
CloneMO01804R
SpecificityThis antibody binds to Medaka TRH.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted; Plasma membrane; Nucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the thyrotropin-releasing hormone family. Cleavage of the encoded proprotein releases mature thyrotropin-releasing hormone, which is a tripeptide hypothalamic regulatory hormone. The human proprotein contains six thyrotropin-releasing hormone tripeptides. Thyrotropin-releasing hormone is involved in the regulation and release of thyroid-stimulating hormone, as well as prolactin. Deficiency of this hormone has been associated with hypothalamic hypothyroidism.
Product OverviewThis product is a mouse antibody against TRH. It can be used for TRH detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPrepro-thyrotropin-releasing hormone; TRH; trh
UniProt IDQ1T735
Protein RefseqThe length of the protein is 270 amino acids long.
The sequence is show below: MKSVCLLILASLAICNFTVSDAQSISAEDETDRTTTTDDIILRRAESLLLRSLLKKMQDEDDINDGVYAQQDWMAKRQHPGKRYREDLEKRQHPGRREEDEDEEYLNAQKRQHPGKREDEIQSSMGLQKRQHPGKRFLTGHISDNPIIMLGELSKRQHPGKRYLVLQSKRQHPGKRYQDDEDSDGDWEAAEEVDLPELEKRQHPGKRFWDNSNPELGNPCDALEPDNCSKTNLLLDFLDNIKEVHEEEKRQHPGKRFALKENEEDAVDSE.
See other products for " TRH "
MO-AB-10313YMouse Anti-Rabbit TRH Antibody (MO-AB-10313Y)
CBMOAB-33400FYAMouse Anti-D. melanogaster Trh Antibody (CBMOAB-33400FYA)
CBMOAB-61088FYAMouse Anti-Rhesus TRH Antibody (CBMOAB-61088FYA)
MO-AB-29760HMouse Anti-Rat Trh Antibody (MO-AB-29760H)
MO-AB-18050YMouse Anti-Sheep TRH Antibody (MO-AB-18050Y)
MO-AB-66851WMouse Anti-Marmoset TRH Antibody (MO-AB-66851W)
CBMOAB-10650FYBMouse Anti-Zebrafish trh Antibody (CBMOAB-10650FYB)
MO-AB-30947RMouse Anti-Pig TRH Antibody (MO-AB-30947R)
MO-AB-06693WMouse Anti-Rhesus TRH Antibody (MO-AB-06693W)
MO-AB-22158RMouse Anti-Cattle TRH Antibody (MO-AB-22158R)
For Research Use Only | Not For Clinical Use.
Online Inquiry