AibGenesis™ Mouse Anti-D. melanogaster Wupa Antibody (CBMOAB-34455FYA)


Cat: CBMOAB-34455FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Specifications
  • Application Information
  • Target

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster)
CloneMO34455FYA
SpecificityThis antibody binds to fruit fly Wupa.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytoskeleton; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionTroponin I is the ATPase inhibitory subunit of troponin in the thin filament regulatory complex. Involved in the development and maintenance of muscle and nervous system. May also be involved in the cytoskeletal apparatus. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-D. melanogaster Wupa Antibody is a mouse antibody against Wupa. It can be used for Wupa detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTroponin I; Tn I; Protein heldup; Protein wings apart-A; wupA; HDP TnI
UniProt IDP36188
Protein RefseqThe length of the protein is 269 amino acids long.
The sequence is show below: MADDEKKAAAPAAAPAAAAKPAAPAAAPAANGKAAPAANGKAAPAAAAAPAGPPKDPNDPKVKAEEAKKAKQAEIERKRAEVRKRMEEASKAKKAKKGFMTPERKKKLRLLLRKKAAEELKKEQERKAAERRRIIEERCGSPRNLSDASEGELQEICEEYYERMYICEGQKWDLEYEVRKKDWEINDLNAQVNDLRGKFVKPALKKVSKYENKFAKLQKKAAEFNFRNQLKVVKKKEFTLEEEEKEKKPDWSKGKPGDAKVKEEVEAEA.
For Research Use Only | Not For Clinical Use.
Online Inquiry