AibGenesis™ Mouse Anti-DAZL1 Antibody (CBMOAB-40412FYA)


Cat: CBMOAB-40412FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-40412FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes) WB, ELISA MO40412FYA 100 µg
MO-AB-10218W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO10218W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes)
CloneMO40412FYA
SpecificityThis antibody binds to Rhesus DAZL1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus DAZL1 Antibody is a mouse antibody against DAZL1. It can be used for DAZL1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesDAZL1 protein; DAZL1
UniProt IDO77586
Protein RefseqThe length of the protein is 119 amino acids long.
The sequence is show below: LPEGKIMPNTVFVGGIDVRMDETEIRSFFARYGSVKEVKIITDRTGVSKGYGFVSFFNDVDVQKIVESQINFHGKKLKLGPAIRKQNLCAYHVQPRPLVFNHPPPPQFQNVWTNPNTET.
For Research Use Only | Not For Clinical Use.
Online Inquiry