AibGenesis™ Mouse Anti-DBNDD2 Antibody (CBMOAB-40423FYA)


Cat: CBMOAB-40423FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-40423FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Rat (Rattus norvegicus) WB, ELISA MO40423FYA 100 µg
MO-AB-01843W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO01843W 100 µg
MO-AB-11197R Monoclonal Cattle (Bos taurus) WB, ELISA MO11197R 100 µg
MO-AB-25286H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO25286C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Rat (Rattus norvegicus)
CloneMO40423FYA
SpecificityThis antibody binds to Rhesus DBNDD2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus DBNDD2 Antibody is a mouse antibody against DBNDD2. It can be used for DBNDD2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesDBNDD2
UniProt IDF7AHR9
Protein RefseqThe length of the protein is 259 amino acids long.
The sequence is show below: ESWALAVFPEYRVSLLQCLELASPLWSGQAPPLHETWSVGHTWFQGRGKRSPRAEVSRLEPGAPLLGRWQWGSPSPGPPCLVFRLCSCTCFAPLPLGADMDPNPRAALERQQLRLRERQKFFEDILQPETEFVFPLSHLHLESQRPPIGSISSMEVNVDTLEQVELIDLGDPDGADVFLPCEDPPPTPQSSGVDNHLEELSLPVLTSDRTTSRTSSSSSDSSTNLHSPNPSDDGADTPLAQSDEEEERGDGGAEPGACS.
For Research Use Only | Not For Clinical Use.
Online Inquiry