AibGenesis™ Mouse Anti-DCAF4 Antibody (CBMOAB-40446FYA)


Cat: CBMOAB-40446FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-40446FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO40446FYA 100 µg
MO-AB-01844W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO01844W 100 µg
MO-AB-11212R Monoclonal Cattle (Bos taurus) WB, ELISA MO11212R 100 µg
MO-AB-19200W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO19200W 100 µg
MO-AB-53945W Monoclonal Marmoset WB, ELISA MO53945W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset
CloneMO40446FYA
SpecificityThis antibody binds to Rhesus DCAF4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a WD repeat-containing protein that interacts with the Cul4-Ddb1 E3 ligase macromolecular complex. Multiple alternatively spliced transcript variants have been found for this gene. (From NCBI)
Product OverviewMouse Anti-Rhesus DCAF4 Antibody is a mouse antibody against DCAF4. It can be used for DCAF4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesDCAF4
UniProt IDF6Q715
Protein RefseqThe length of the protein is 489 amino acids long.
The sequence is show below: MNKSSWQSRRRHGRRSHQQNPWFRLRDPEDRSDSQAARSAQDSSHGDDESPSTSSGTAGASSVPELPGFYFDPEKKRYFRLLPGHNNCNPLTKESIRQKEMESKRLRLLEEEDKQKKIARMGFNASSMLRKSQLGFLNVTSYCHLAHELRLSCMERKKVQIRSLDPSALASDRFNLILADTNSDRLFTVNDVKVGGSKYGIINLQSLKTPTLKVFMHENLYFTNRKVNSVCWASLNHLDSHILLCLMGLAETPGCATLLPASLFVNSHPAGIDRPGMLCSFRIPGAWSCAWSLNIQANNCFSTGLSRRVLLTNVVTGHRQSFGTNSDVLVPLLFNGCRSGEIFAIDLRCGNQGKGWKATRLFHDSAVTSVRILQDEQYLMASDMAGKIKLWDLRTTKCIRQYEGHVNEYAYLPLHVHEEEGILVAVGQDCYTRIWSLHDAHLLRTIPSPYPASKADIPSVAFSSRLGGSRGAPGLLMAVGQDLYCYSYS.
For Research Use Only | Not For Clinical Use.
Online Inquiry