AibGenesis™ Mouse Anti-Defb3 Antibody (MO-AB-11217Y)


Cat: MO-AB-11217Y

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-11217Y Monoclonal O. mykiss (Oncorhynchus mykiss), Cattle (Bos taurus), Horse (Equus caballus), Rat (Rattus norvegicus) WB, ELISA MO11217Y 100 µg
Inquiry
MO-AB-11343R Monoclonal Cattle (Bos taurus) WB, ELISA MO11343R 100 µg
Inquiry
MO-AB-25359H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO25359C 100 µg
Inquiry
MO-AB-44404W Monoclonal Horse (Equus caballus) WB, ELISA MO44404W 100 µg
Inquiry

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityO. mykiss (Oncorhynchus mykiss), Cattle (Bos taurus), Horse (Equus caballus), Rat (Rattus norvegicus)
CloneMO11217Y
SpecificityThis antibody binds to O. mykiss Defb3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewThis product is a mouse antibody against Defb3. It can be used for Defb3 detection in Western Blot and Enzyme-Linked Immunosorbent Assay.
Alternative NamesDefensin beta 3; defb3
UniProt IDC9WX70
Protein RefseqThe length of the protein is 62 amino acids long. The sequence is show below: MRLMILMLVALLVIACGIQESSASLHLCFISGGGCRNLRLCLASGGTNIGKMGCTWPNVCCK.
For Research Use Only | Not For Clinical Use.
Online Inquiry