AibGenesis™ Mouse Anti-Defb3 Antibody (MO-AB-11217Y)
Cat: MO-AB-11217Y

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| MO-AB-11217Y | Monoclonal | O. mykiss (Oncorhynchus mykiss), Cattle (Bos taurus), Horse (Equus caballus), Rat (Rattus norvegicus) | WB, ELISA | MO11217Y | 100 µg | ||
| MO-AB-11343R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO11343R | 100 µg | ||
| MO-AB-25359H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO25359C | 100 µg | ||
| MO-AB-44404W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO44404W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | O. mykiss (Oncorhynchus mykiss), Cattle (Bos taurus), Horse (Equus caballus), Rat (Rattus norvegicus) |
| Clone | MO11217Y |
| Specificity | This antibody binds to O. mykiss Defb3. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Product Overview | This product is a mouse antibody against Defb3. It can be used for Defb3 detection in Western Blot and Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Defensin beta 3; defb3 |
| UniProt ID | C9WX70 |
| Protein Refseq | The length of the protein is 62 amino acids long. The sequence is show below: MRLMILMLVALLVIACGIQESSASLHLCFISGGGCRNLRLCLASGGTNIGKMGCTWPNVCCK. |
For Research Use Only | Not For Clinical Use.
Online Inquiry