AibGenesis™ Mouse Anti-derl2 Antibody (CBMOAB-73358FYA)


Cat: CBMOAB-73358FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-73358FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO73358FYA 100 µg
MO-AB-11370R Monoclonal Cattle (Bos taurus) WB, ELISA MO11370R 100 µg
MO-AB-14458W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO14458W 100 µg
MO-AB-54116W Monoclonal Marmoset WB, ELISA MO54116W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset
CloneMO73358FYA
SpecificityThis antibody binds to Zebrafish derl2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationEndoplasmic reticulum

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish derl2 Antibody is a mouse antibody against derl2. It can be used for derl2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZgc:110436; Zgc:110436 protein; derl2; zgc:11043
UniProt IDQ4VBS8
Protein RefseqThe length of the protein is 239 amino acids long.
The sequence is show below: MAYQTIRQEYLQIPVVTRAYTTACVLTTAAVQLELITPFQLYFNPDLILRNYQVWRLITNFLFFGPVGFNFLFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGGLLMTIFGTFVNLVFLGQAFTIMLVYIWSRRNPNVRMNFFGLLNFQAPFLPWVLMGFSLLLGNSIIVDLLGIAVGHVYYFLEDVFPNQPGGGRWLRTPSILKMLFDTPEEDANYNPLPEDRPGGFAWGEGQRLGG.
For Research Use Only | Not For Clinical Use.
Online Inquiry