Mouse Anti-DGAT2 Antibody (MO-AB-11390R)


Cat: MO-AB-11390R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-11390R Monoclonal Cattle (Bos taurus), C. elegans (Caenorhabditis elegans), Chimpanzee (Pan troglodytes), Goat (Capra hircus), Zebrafish (Danio rerio) WB, ELISA MO11390R 100 µg
CBMOAB-73391FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO73391FYA 100 µg
CBMOAB-02627HCB Monoclonal C. elegans (Caenorhabditis elegans) WB, ELISA MO02627HB 100 µg
MO-AB-19545W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO19545W 100 µg
MO-AB-37131W Monoclonal Goat (Capra hircus) WB, ELISA MO37131W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), C. elegans (Caenorhabditis elegans), Chimpanzee (Pan troglodytes), Goat (Capra hircus), Zebrafish (Danio rerio)
CloneMO11390R
SpecificityThis antibody binds to Cattle DGAT2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Endoplasmic reticulum

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes one of two enzymes which catalyzes the final reaction in the synthesis of triglycerides in which diacylglycerol is covalently bound to long chain fatty acyl-CoAs. The encoded protein catalyzes this reaction at low concentrations of magnesium chloride while the other enzyme has high activity at high concentrations of magnesium chloride. Multiple transcript variants encoding different isoforms have been found for this gene.
Product OverviewMouse Anti-Cattle DGAT2 Antibody is a mouse antibody against DGAT2. It can be used for DGAT2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesDiacylglycerol O-acyltransferase 2; EC 2.3.1.20; Acyl-CoA retinol O-fatty-acyltransferase; ARAT; Retinol O-fatty-acyltransferase; EC 2.3.1.76; Diglyceride acyltransferase 2; DGAT2
UniProt IDQ70VZ8
Protein RefseqThe length of the protein is 361 amino acids long.
The sequence is show below: MKTLIAAYSGVLRGTGSSILSALQDLFSVTWLNRAKVEKQLQVISVLQWVLSFLVLGVACSVILMYTFCTDCWLIAVLYFTWLVFDWNTPKKGGRRSQWVRNWAVWRYFRDYFPIQLVKTHNLLTSRNYIFGYHPHGIMGLGAFCNFSTEATEVSKKFPGIRPYLATLAGNFRMPVLREYLMSGGICPVNRDTIDYLLSKNGSGNAIIIVVGGAAESLSSMPGKNAVTLRNRKGFVKLALRHGADLVPTYSFGEN.
For Research Use Only | Not For Clinical Use.
Online Inquiry