AibGenesis™ Mouse Anti-dgat2 Antibody (MO-AB-23136H)
Cat: MO-AB-23136H

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| MO-AB-23136H | Monoclonal | Mallard (Anas platyrhynchos), C. elegans (Caenorhabditis elegans), Chimpanzee (Pan troglodytes), Goat (Capra hircus), Zebrafish (Danio rerio) | WB, ELISA | MO23136C | 100 µg | ||
| CBMOAB-73391FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO73391FYA | 100 µg | ||
| CBMOAB-02627HCB | Monoclonal | C. elegans (Caenorhabditis elegans) | WB, ELISA | MO02627HB | 100 µg | ||
| MO-AB-19545W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO19545W | 100 µg | ||
| MO-AB-37131W | Monoclonal | Goat (Capra hircus) | WB, ELISA | MO37131W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Mallard (Anas platyrhynchos), C. elegans (Caenorhabditis elegans), Chimpanzee (Pan troglodytes), Goat (Capra hircus), Zebrafish (Danio rerio) |
| Clone | MO23136C |
| Specificity | This antibody binds to Mallard dgat2. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes one of two enzymes which catalyzes the final reaction in the synthesis of triglycerides in which diacylglycerol is covalently bound to long chain fatty acyl-CoAs. The encoded protein catalyzes this reaction at low concentrations of magnesium chloride while the other enzyme has high activity at high concentrations of magnesium chloride. Multiple transcript variants encoding different isoforms have been found for this gene. (From NCBI) |
| Product Overview | This product is a mouse antibody against dgat2. It can be used for dgat2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Putative diacylglycerol O-acyltransferase homolog 2; dgat2 |
| UniProt ID | A7WPN5 |
| Protein Refseq | The length of the protein is 48 amino acids long. The sequence is show below: GNAIIIVVGGAAESLNCTPGKNSVTLKNRKGFVKLALRHGADLVPVYS. |
See other products for " DGAT2 "
| CBMOAB-27453FYC | AibGenesis™ Mouse Anti-DGAT2 Antibody (CBMOAB-27453FYC) |
| MO-AB-11390R | AibGenesis™ Mouse Anti-DGAT2 Antibody (MO-AB-11390R) |
| MO-AB-54127W | AibGenesis™ Mouse Anti-DGAT2 Antibody (MO-AB-54127W) |
| MO-AB-25361R | AibGenesis™ Mouse Anti-DGAT2 Antibody (MO-AB-25361R) |
| MO-AB-01874W | AibGenesis™ Mouse Anti-DGAT2 Antibody (MO-AB-01874W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry