AibGenesis™ Mouse Anti-DHRSX Antibody (CBMOAB-40745FYA)


Cat: CBMOAB-40745FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-40745FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO40745FYA 100 µg
CBMOAB-73486FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO73486FYA 100 µg
MO-AB-02981H Monoclonal Frog (Xenopus laevis) WB, ELISA MO02981C 100 µg
MO-AB-24341W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO24341W 100 µg
MO-AB-25396H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO25396C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO40745FYA
SpecificityThis antibody binds to Rhesus DHRSX.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus DHRSX Antibody is a mouse antibody against DHRSX. It can be used for DHRSX detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesDHRSX
UniProt IDH9H3I7
Protein RefseqThe length of the protein is 148 amino acids long.
The sequence is show below: AGVMMVPQRKTRDGFEEHFGLNYLGHFLLTNLLLDTLRESGSPGHSARVVTVSSATHYVAELNMDDLQSSACYSAHAAYAQSKLALVLFTYHLQRLLAAEGSHVTANVVDPGVVHTDLYQHVFWGTRLVMKLFSWLLFKTPREGSWIS.
For Research Use Only | Not For Clinical Use.
Online Inquiry