AibGenesis™ Mouse Anti-DIO1 Antibody (CBMOAB-40780FYA)


Cat: CBMOAB-40780FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-40780FYA Monoclonal Rhesus (Macaca mulatta), Cat (Felis catus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Guinea pig (Cavia porcellus), Marmoset, Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries), Zebrafish (Danio rerio) WB, ELISA MO40780FYA 100 µg
Inquiry
CBMOAB-73552FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO73552FYA 100 µg
Inquiry
MO-AB-01593Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO01593Y 100 µg
Inquiry
MO-AB-07903Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO07903Y 100 µg
Inquiry
MO-AB-08492W Monoclonal Cat (Felis catus) WB, ELISA MO08492W 100 µg
Inquiry
MO-AB-14953Y Monoclonal Sheep (Ovis aries) WB, ELISA MO14953Y 100 µg
Inquiry
MO-AB-17949W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO17949W 100 µg
Inquiry
MO-AB-30156W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO30156W 100 µg
Inquiry
MO-AB-41568W Monoclonal Guinea pig (Cavia porcellus) WB, ELISA MO41568W 100 µg
Inquiry
MO-AB-54209W Monoclonal Marmoset WB, ELISA MO54209W 100 µg
Inquiry

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cat (Felis catus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Guinea pig (Cavia porcellus), Marmoset, Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries), Zebrafish (Danio rerio)
CloneMO40780FYA
SpecificityThis antibody binds to Rhesus DIO1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene belongs to the iodothyronine deiodinase family. It catalyzes the activation, as well as the inactivation of thyroid hormone by outer and inner ring deiodination, respectively. The activation reaction involves the conversion of the prohormone thyroxine (3,5,3',5'-tetraiodothyronine, T4), secreted by the thyroid gland, to the bioactive thyroid hormone (3,5,3'-triiodothyronine, T3) by 5'-deiodination. This protein is expressed predominantly in the liver and kidney and provides most of the circulating T3, which is essential for growth, differentiation and basal metabolism in vertebrates. This protein is a selenoprotein, containing the rare amino acid selenocysteine (Sec) at its active site. Sec is encoded by the UGA codon, which normally signals translation termination. The 3' UTRs of selenoprotein mRNAs contain a conserved stem-loop structure, designated the Sec insertion sequence (SECIS) element, that is necessary for the recognition of UGA as a Sec codon, rather than as a stop signal. Alternatively spliced transcript variants have been found for this gene. (From NCBI)
Product OverviewMouse Anti-Rhesus DIO1 Antibody is a mouse antibody against DIO1. It can be used for DIO1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesIodothyronine deiodinase; DIO1
UniProt IDF7CN29
Protein RefseqThe length of the protein is 113 amino acids long.
The sequence is show below: MGLPQSGLWVKKLWVLLEVAVHVVVGKVLLILFPDRVKRNILAMGEKTGMTRNPHFSHDNWIPTFFSTQYFWFVLKVRWQRLEDTTELGGLAPNCPVVRLSGQRCNIWDFMQG.
For Research Use Only | Not For Clinical Use.
Online Inquiry