AibGenesis™ Mouse Anti-dlx6a Antibody (CBMOAB-73700FYA)


Cat: CBMOAB-73700FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-73700FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO73700FYA 100 µg
MO-MMB-0603 Polyclonal Zebrafish (Danio rerio) WB 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO73700FYA
SpecificityThis antibody binds to Zebrafish dlx6a.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish dlx6a Antibody is a mouse antibody against dlx6a. It can be used for dlx6a detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesHomeobox protein Dlx6a; Distal-less homeobox protein 6a; DLX-6; dlx6a; dlx
UniProt IDQ98877
Protein RefseqThe length of the protein is 247 amino acids long.
The sequence is show below: MMTMTTMADGLEAQDSSKSAFMEFGQQSHSQQSSPSMAASHYPLHCLHSGSHHHHQHDSSPYSGSNSYNRSLPYSYVSHPHHSPYLPSYHSNASGTQTRLDATEQQKTTVIENGEIRFNGKGKKIRKPRTIYSSLQLQALNHRFQQTQYLALPERAELAASLGLTQTQVKIWFQNKRSKFKKLLKQGGNPHETDTLPGSIALSPRSPAIPPIWDVSASSKGVNMSANSYMPGYSHWYSSPHQDAMQR.
For Research Use Only | Not For Clinical Use.
Online Inquiry