Mouse Anti-DMP1 Antibody (MO-AB-00378L)
Cat: MO-AB-00378L
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
MO-AB-00378L | Monoclonal | Elephant (Loxodonta africana), Cattle (Bos taurus), Fruit fly (Drosophila melanogaster), Hamsters (Cricetinae), Horse (Equus caballus), Sheep (Ovis aries) | WB, ELISA | MO00378L | 100 µg | ||
MO-AB-02473W | Monoclonal | Fruit fly (Drosophila melanogaster) | WB, ELISA | MO02473W | 100 µg | ||
MO-AB-43077W | Monoclonal | Hamsters (Cricetinae) | WB, ELISA | MO43077W | 100 µg | ||
MO-AB-44435W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO44435W | 100 µg | ||
MO-AB-11501R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO11501R | 100 µg | ||
MO-AB-14967Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO14967Y | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Elephant (Loxodonta africana), Cattle (Bos taurus), Fruit fly (Drosophila melanogaster), Hamsters (Cricetinae), Horse (Equus caballus), Sheep (Ovis aries) |
Clone | MO00378L |
Specificity | This antibody binds to Elephant DMP1. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Dentin matrix acidic phosphoprotein is an extracellular matrix protein and a member of the small integrin binding ligand N-linked glycoprotein family. This protein, which is critical for proper mineralization of bone and dentin, is present in diverse cells of bone and tooth tissues. The protein contains a large number of acidic domains, multiple phosphorylation sites, a functional arg-gly-asp cell attachment sequence, and a DNA binding domain. In undifferentiated osteoblasts it is primarily a nuclear protein that regulates the expression of osteoblast-specific genes. During osteoblast maturation the protein becomes phosphorylated and is exported to the extracellular matrix, where it orchestrates mineralized matrix formation. Mutations in the gene are known to cause autosomal recessive hypophosphatemia, a disease that manifests as rickets and osteomalacia. The gene structure is conserved in mammals. Two transcript variants encoding different isoforms have been described for this gene. (From NCBI) |
Product Overview | This product is a mouse antibody against DMP1. It can be used for DMP1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Dentin Matrix Acidic Phosphoprotein 1; Dentin Matrix Protein 1; DMP-1; Dentin Matrix Acidic Phosphoprotein; ARHP; ARHR |
UniProt ID | G5CXB6 |
Protein Refseq | The length of the protein is 436 amino acids long. The sequence is show below: GRGHDDRQYIYRPADGLSRRGGKGGDDKDDDEDDSGDDTFGDEDNGLGPEEGHEGGNVRLQSDEDSADTTQSREDSTPQGEDSDQDTTIESREVDNEGEVNSRPEAGDFTHESESEERWVGGGSEGDSSHGDGFEFDDEEMQSDDPDSVRSDRNNSRMSSASIKSEESKGKSDEQASTQDSDGSQSAENPRRKFFRKSRLSDEDDRSELVBSNTMEEFKSDSSENSSSKEIGLSQSRENKSDSREDSKENQSQEDNQNVQDLSSESSQEADLPPQENSSESQEEVVSESRGDNPDQNTTNHSEEDQEDSDSSEEDNVSKPSNSESESREEQADSDSNESLKSSEESPESVEDENSSSQESLQSQSASTESQSEESQSEQDSQSVEDDDSDSQDSSRSKEDSNSTESKSSSEEDGQSKNTEIESRKLTVDIYHNKPI. |
See other products for " DMP1 "
MO-AB-54303W | Mouse Anti-DMP1 Antibody (MO-AB-54303W) |
CBMOAB-40897FYA | Mouse Anti-DMP1 Antibody (CBMOAB-40897FYA) |
MO-AB-25407R | Mouse Anti-DMP1 Antibody (MO-AB-25407R) |
MO-AB-41574W | Mouse Anti-DMP1 Antibody (MO-AB-41574W) |
MO-AB-03014H | Mouse Anti-DMP1 Antibody (MO-AB-03014H) |
CBMOAB-27752FYC | Mouse Anti-DMP1 Antibody (CBMOAB-27752FYC) |
CBMOAB-60374FYC | Mouse Anti-DMP1 Antibody (CBMOAB-60374FYC) |
MO-AB-01630Y | Mouse Anti-DMP1 Antibody (MO-AB-01630Y) |
For Research Use Only | Not For Clinical Use.
Online Inquiry