Mouse Anti-DMP1 Antibody (MO-AB-54303W)


Cat: MO-AB-54303W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-54303W Monoclonal Marmoset, Cattle (Bos taurus), Fruit fly (Drosophila melanogaster), Hamsters (Cricetinae), Horse (Equus caballus), Sheep (Ovis aries) WB, ELISA MO54303W 100 µg
MO-AB-02473W Monoclonal Fruit fly (Drosophila melanogaster) WB, ELISA MO02473W 100 µg
MO-AB-43077W Monoclonal Hamsters (Cricetinae) WB, ELISA MO43077W 100 µg
MO-AB-44435W Monoclonal Horse (Equus caballus) WB, ELISA MO44435W 100 µg
MO-AB-11501R Monoclonal Cattle (Bos taurus) WB, ELISA MO11501R 100 µg
MO-AB-14967Y Monoclonal Sheep (Ovis aries) WB, ELISA MO14967Y 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityMarmoset, Cattle (Bos taurus), Fruit fly (Drosophila melanogaster), Hamsters (Cricetinae), Horse (Equus caballus), Sheep (Ovis aries)
CloneMO54303W
SpecificityThis antibody binds to Marmoset DMP1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionDentin matrix acidic phosphoprotein is an extracellular matrix protein and a member of the small integrin binding ligand N-linked glycoprotein family. This protein, which is critical for proper mineralization of bone and dentin, is present in diverse cells of bone and tooth tissues. The protein contains a large number of acidic domains, multiple phosphorylation sites, a functional arg-gly-asp cell attachment sequence, and a DNA binding domain. In undifferentiated osteoblasts it is primarily a nuclear protein that regulates the expression of osteoblast-specific genes. During osteoblast maturation the protein becomes phosphorylated and is exported to the extracellular matrix, where it orchestrates mineralized matrix formation. Mutations in the gene are known to cause autosomal recessive hypophosphatemia, a disease that manifests as rickets and osteomalacia. The gene structure is conserved in mammals. Two transcript variants encoding different isoforms have been described for this gene.
Product OverviewMouse Anti-Marmoset DMP1 Antibody is a mouse antibody against DMP1. It can be used for DMP1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesDentin matrix protein 1; DMP1
UniProt IDG5CXI6
Protein RefseqThe length of the protein is 425 amino acids long.
The sequence is show below: ERLGSDDHQYIYRPTGGFSRSTGEGYDKDDDEDDSGDDTFGDDDNGLVPKDRQEGENSKLGSDEDSADTTQSSEEGAPQGQDSAQDTTSESRDLDNEDQVDSRPEGGDSTQESESEEHWVGGGSEGESSHGDGSEFDDEGMQSDDPDSIRSERGNSRMNSARMKSKESRENSGQANIRDSGDSQLVEHPSKKNFRKSRISEEDDKGELDDNNTMEEVRSDSTENSNSREAGLSQPRRDSKGDSQEDSKENPSQEDSQNLDGPSSESSQEADLPSQENSSESQEEVVSEPRGDNPDPTTSYVEDQEDSDSSEEDSLHTLSHSESESREEQADSESSESLNSSEESPESPEDENSSSQEGLQSHSSSAESQSEESQSEEDDSDSQDSSRSKEDSNSTESKSSSEEDGQLKNIEIESRKLTVDAYHNK.
For Research Use Only | Not For Clinical Use.
Online Inquiry