AibGenesis™ Mouse Anti-dnaaf3 Antibody (CBMOAB-73754FYA)


Cat: CBMOAB-73754FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-73754FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Rhesus (Macaca mulatta) WB, ELISA MO73754FYA 100 µg
MO-AB-03614W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO03614W 100 µg
MO-AB-11513R Monoclonal Cattle (Bos taurus) WB, ELISA MO11513R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Rhesus (Macaca mulatta)
CloneMO73754FYA
SpecificityThis antibody binds to Zebrafish dnaaf3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is required for the assembly of axonemal inner and outer dynein arms and plays a role in assembling dynein complexes for transport into cilia. Defects in this gene are a cause of primary ciliary dyskinesia type 2 (CILD2). Several transcript variants encoding different isoforms have been found for this gene. (From NCBI)
Product OverviewMouse Anti-Zebrafish dnaaf3 Antibody is a mouse antibody against dnaaf3. It can be used for dnaaf3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesDynein assembly factor 3, axonemal; dnaaf
UniProt IDF1Q7Z7
Protein RefseqThe length of the protein is 469 amino acids long.
The sequence is show below: MSAGRTFEGAGCVTWWGFGPARDLLNSDTHKVRLQEELNVLLVGSGDPRHILKTITGLTHSDTLHVWVIENSMEVIARQLLLLYISLLPPDKMSVHKKTEVFLEVFGNLEIRKETEESVKKAAAQLSISITYSLSSDSLSHSCLDTSLLKFKERDELVRIFKLWERPPSAPASVSKVWDARVRQHLGSRYDSRQGAFDWDLNMKLHQRGCGVINKHQYAKWRETGVTFEMREGLYQTANQSLLSTRVFNHRGNGVALRGYWGDIVSSPYLSFGIETENKELLKTQNNHYVKTAQDISEVNLLELFECLAARGRSPLNEDPPNTSSSCCQSTESRKTEENSQSDPSASQTQPVEHSPTQELDLLNVNGVKVSFLSPDSLSKLPLKSKYRNLFNTIFCSASMVHQLDSALREIAAPDAALVIELATFLLDLSKEQVSGFAVKVKEIAEESGFTPAHDQNSDKYAVFTQKNN.
For Research Use Only | Not For Clinical Use.
Online Inquiry