AibGenesis™ Mouse Anti-dnajc12 Antibody (CBMOAB-73829FYA)


Cat: CBMOAB-73829FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-73829FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Goat (Capra hircus), Horse (Equus caballus), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO73829FYA 100 µg
MO-AB-11543R Monoclonal Cattle (Bos taurus) WB, ELISA MO11543R 100 µg
MO-AB-14609W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO14609W 100 µg
MO-AB-25442H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO25442C 100 µg
MO-AB-37141W Monoclonal Goat (Capra hircus) WB, ELISA MO37141W 100 µg
MO-AB-44440W Monoclonal Horse (Equus caballus) WB, ELISA MO44440W 100 µg
MO-AB-54352W Monoclonal Marmoset WB, ELISA MO54352W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Goat (Capra hircus), Horse (Equus caballus), Marmoset, Rat (Rattus norvegicus)
CloneMO73829FYA
SpecificityThis antibody binds to Zebrafish dnajc12.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of a subclass of the HSP40/DnaJ protein family. Members of this family of proteins are associated with complex assembly, protein folding, and export. Two transcript variants encoding distinct isoforms have been identified for this gene. (From NCBI)
Product OverviewMouse Anti-Zebrafish dnajc12 Antibody is a mouse antibody against dnajc12. It can be used for dnajc12 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namesdnajc12; DnaJ Heat Shock Protein Family (Hsp40) Member C12
UniProt IDE7F5S9
Protein RefseqThe length of the protein is 188 amino acids long.
The sequence is show below: MEAILNCRKEDLEDYYGLLGCDELSTTEQIVNEFKVKALACHPDKHPENPKAVEQFQKLQEAKEVLTDEKKRKSYDLWLRSQIKIPFGEWRALSDSVKTSMHWAVKAKKEPMLEAAEDSNPSDENTVQEKPSEASLPSNVIVCFTLKGHLFCPFLIYSKGRRDYWHQRFRWAGEAPTGLLQKFRNYEI.
For Research Use Only | Not For Clinical Use.
Online Inquiry