AibGenesis™ Mouse Anti-DNAJC14 Antibody (CBMOAB-40973FYA)


Cat: CBMOAB-40973FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-40973FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes) WB, ELISA MO40973FYA 100 µg
MO-AB-11544R Monoclonal Cattle (Bos taurus) WB, ELISA MO11544R 100 µg
MO-AB-13188W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO13188W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes)
CloneMO40973FYA
SpecificityThis antibody binds to Rhesus DNAJC14.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus DNAJC14 Antibody is a mouse antibody against DNAJC14. It can be used for DNAJC14 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesDNAJC14
UniProt IDF7GZ68
Protein RefseqThe length of the protein is 281 amino acids long.
The sequence is show below: MAQKHPGERGLCGAHHSGGASLRTLGPSVDPEIPSFSGLRDSAGTAPNGTRCFTEHSGPKYTQHPNPAHWLDPSHGPPRGPGPPRDAEDPDQSETSSEEESGVDQELSKEDEAGYQEDGNPSFLSIPSACNCQGTPGIPEGPYSEGENGSSSNFCHHCTSPALGEDEELEEEYDDEESLKFPSDFSRVSSGKKPASRRQRHRFPTKEDTREGGRRDPRSPGRHRLGRKRSQAAKRRGLGLWGAEELCPSNVDAPSFLKTMSGSQKGCSTGWSLIYPSSPNT.
For Research Use Only | Not For Clinical Use.
Online Inquiry