AibGenesis™ Mouse Anti-dnajc5b Antibody (CBMOAB-73862FYA)


Cat: CBMOAB-73862FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-73862FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus) WB, ELISA MO73862FYA 100 µg
MO-AB-11296W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO11296W 100 µg
MO-AB-11560R Monoclonal Cattle (Bos taurus) WB, ELISA MO11560R 100 µg
MO-AB-25449H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO25449C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus)
CloneMO73862FYA
SpecificityThis antibody binds to Zebrafish dnajc5b.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the DNAJ heat shock protein 40 family of co-chaperone proteins that is characterized by an N-terminal DNAJ domain, a linker region, and a cysteine-rich C-terminal domain. The encoded protein, together with heat shock protein 70, is thought to regulate the proper folding of other proteins. The orthologous mouse protein is membrane-associated and is targeted to the trans-golgi network. (From NCBI)
Product OverviewMouse Anti-Zebrafish dnajc5b Antibody is a mouse antibody against dnajc5b. It can be used for dnajc5b detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namesdnajc5b; DnaJ Heat Shock Protein Family (Hsp40) Member C5 Beta
UniProt IDX1WFT6
Protein RefseqThe length of the protein is 196 amino acids long.
The sequence is show below: MAEQRQRALSTSGEALYQVLGLDKNCTHDDIKRSYSRKLALKYHPDKNPENPDATDKFKELNNAHAVLSDVTKRNIYDKYGSLGLYVSQQFGEENVNTYFMLSSWWAKGLFAICGLLTGCYFCCCLCCCFNCCCGKCKPHTPGEEDPEVYVSPEDLEEQIRTDNERDGDTPIVLQPTNASEKTQLIGDGHRSYTTE.
For Research Use Only | Not For Clinical Use.
Online Inquiry