Mouse Anti-Dog BGLAP Antibody (MO-AB-29242W)
Cat: MO-AB-29242W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Dog (Canis lupus familiaris) |
Clone | MO29242W |
Specificity | This antibody binds to Dog BGLAP. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Extracellular region or secreted; Other locations |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes a highly abundant bone protein secreted by osteoblasts that regulates bone remodeling and energy metabolism. The encoded protein contains a Gla (gamma carboxyglutamate) domain, which functions in binding to calcium and hydroxyapatite, the mineral component of bone. Serum osteocalcin levels may be negatively correlated with metabolic syndrome. Read-through transcription exists between this gene and the neighboring upstream gene, PMF1 (polyamine-modulated factor 1), but the encoded protein only shows sequence identity with the upstream gene product. |
Product Overview | Mouse Anti-Dog BGLAP Antibody is a mouse antibody against BGLAP. It can be used for BGLAP detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Osteocalcin; Bone Gla protein; BGP; Gamma-carboxyglutamic acid-containing protein; BGLAP |
UniProt ID | P81455 |
Protein Refseq | The length of the protein is 49 amino acids long. The sequence is show below: YLDSGLGAPVPYPDPLEPKREVCELNPNCDELADHIGFQEAYQRFYGPV. |
See other products for " bglap "
CBMOAB-67643FYA | Mouse Anti-Zebrafish bglap Antibody (CBMOAB-67643FYA) |
MOFY-0622-FY60 | Rabbit Anti-BGLAP Antibody (MOFY-0622-FY60) |
MO-AB-09730W | Mouse Anti-Cat BGLAP Antibody (MO-AB-09730W) |
MOFY-0722-FY269 | Rabbit Anti-BGLAP Antibody (MOFY-0722-FY269) |
MO-AB-07341Y | Mouse Anti-Rabbit BGLAP Antibody (MO-AB-07341Y) |
MO-AB-08071R | Mouse Anti-Cattle BGLAP Antibody (MO-AB-08071R) |
MO-AB-36770W | Mouse Anti-Goat BGLAP Antibody (MO-AB-36770W) |
MO-AB-43853W | Mouse Anti-Horse BGLAP Antibody (MO-AB-43853W) |
MO-AB-24371H | Mouse Anti-Rat Bglap Antibody (MO-AB-24371H) |
MOFAB-124W | Mouse Anti-BGLAP Antibody (MOFAB-124W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry