Mouse Anti-Dog CD1D Antibody (MO-AB-29451W)
Cat: MO-AB-29451W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Dog (Canis lupus familiaris) |
Clone | MO29451W |
Specificity | This antibody binds to Dog CD1D. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | CD1D (CD1d Molecule) is a Protein Coding gene. Diseases associated with CD1D include Mycobacterium Malmoense and Autoimmune Disease. Among its related pathways are Innate Immune System and Amoebiasis. Gene Ontology (GO) annotations related to this gene include receptor activity and cell adhesion molecule binding. An important paralog of this gene is CD1E. |
Product Overview | Mouse Anti-Dog CD1D Antibody is a mouse antibody against CD1D. It can be used for CD1D detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | MHC-like protein; CD1D |
UniProt ID | D6Q1Q6 |
Protein Refseq | The length of the protein is 50 amino acids long. The sequence is show below: LVCHVSGFHPKPVQVTWMRGEQEQQGTQRGDILPHADGTWYLRVTLDVAA. |
See other products for " CD1D "
MO-AB-00192L | Mouse Anti-Elephant CD1D Antibody (MO-AB-00192L) |
MO-AB-14491Y | Mouse Anti-Sheep CD1D Antibody (MO-AB-14491Y) |
MO-AB-41370W | Mouse Anti-Guinea pig CD1D Antibody (MO-AB-41370W) |
MO-AB-09788R | Mouse Anti-Cattle CD1D Antibody (MO-AB-09788R) |
MO-AB-07519Y | Mouse Anti-Rabbit CD1D Antibody (MO-AB-07519Y) |
MO-AB-43993W | Mouse Anti-Horse CD1D Antibody (MO-AB-43993W) |
MO-AB-24436R | Mouse Anti-Pig cd1d Antibody (MO-AB-24436R) |
CBMOAB-38651FYA | Mouse Anti-Rhesus CD1D Antibody (CBMOAB-38651FYA) |
For Research Use Only | Not For Clinical Use.
Online Inquiry