Mouse Anti-Horse CD1D Antibody (MO-AB-43993W)


Cat: MO-AB-43993W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityHorse (Equus caballus)
CloneMO43993W
SpecificityThis antibody binds to Horse CD1D.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted; Plasma membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCD1D (CD1d Molecule) is a Protein Coding gene. Diseases associated with CD1D include Mycobacterium Malmoense and Autoimmune Disease. Among its related pathways are Innate Immune System and Amoebiasis. Gene Ontology (GO) annotations related to this gene include receptor activity and cell adhesion molecule binding. An important paralog of this gene is CD1E.
Product OverviewMouse Anti-Horse CD1D Antibody is a mouse antibody against CD1D. It can be used for CD1D detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCD1 protein; CD1D
UniProt IDF6RUT0
Protein RefseqThe length of the protein is334 amino acids long.
The sequence is show below: MRCLLFLLLWGLPQIRRTSEVPQRNFPFRCLQISSFLNRSWARTDALAWLGELQPYVWKNDSDTIRFLKPWSQGTFSDQQCEELQHLFRVYRSSVTRDIQEFAKMLHIAYPLEVQVSAGCEVHPGNTSESFLYAAFQGRDILSFQGTSWVPAPDTPQWVARVIEVLNDDQGTREMVQSLLNDTCPQFVRGLLETGKSELDRQVKPEAWLSSGPAPGPGRLLLVCHVSGFYPKPVWVMWMRGEQEEPSTQQGDILPNADETWYLRVTLDVVAGEAAGLTCRVRHSSLGGQDIILYWEQSRASAGLIAGAVLVSLLIAGGLLTCWFKKRSSYQDIL.
For Research Use Only | Not For Clinical Use.
Online Inquiry