Mouse Anti-Dog CLU Antibody (MO-AB-29606W)


Cat: MO-AB-29606W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityDog (Canis lupus familiaris)
CloneMO29606W
SpecificityThis antibody binds to Dog CLU.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted; Cytosol; Cytoskeleton; Other locations; Golgi apparatus; Mitochondrion; Nucleus; Endoplasmic reticulum

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a secreted chaperone that can under some stress conditions also be found in the cell cytosol. It has been suggested to be involved in several basic biological events such as cell death, tumor progression, and neurodegenerative disorders. Alternate splicing results in both coding and non-coding variants.
Product OverviewMouse Anti-Dog CLU Antibody is a mouse antibody against CLU. It can be used for CLU detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesClusterin; Glycoprotein 80; Gp80; [Cleaved into: Clusterin beta chain; Clusterin alpha chain]; CLU
UniProt IDP25473
Protein RefseqThe length of the protein is 445 amino acids long.
The sequence is show below: MMKTLLLLVGLLLTWDNGRVLGDQAVSDTELQEMSTEGSKYINKEIKNALKGVKQIKTLIEQTNEERKSLLSNLEEAKKKKEDALNDTKDSETKLKASQGVCNDTMMALWEECKPCLKQTCMKFYARVCRSGSGLVGHQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQTHALDVMQDSFNRASSIMDELFQDRFFTREPQDTYHYSPFSLFQRRPFFNPKFRIARNIIPFPRFQPLNFHDMFQPFFDMIHQAQQAMDVNLHRIPYHFPIEFPEEDNRTVCKEIRHNSTGCLKMKDQCEKCQEILSVDCSSNNPAQVQLRQELSNSLQIAEKFTKLYDELLQSYQEKMFNTSSLLKQLNEQFSWVSQLANLTQSEDPFYLQVTTVGSQTSDSNVPVGFTKVVVKLFDSDPITVMIPEAVSRNNPKFMETVAEKALQEYRQKHREE.
For Research Use Only | Not For Clinical Use.
Online Inquiry