Mouse Anti-Dog COX7A2 Antibody (MO-AB-29878W)
Cat: MO-AB-29878W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Dog (Canis lupus familiaris) |
Clone | MO29878W |
Specificity | This antibody binds to Dog COX7A2. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Mitochondrion; Other locations |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | COX7A2 (Cytochrome C Oxidase Subunit 7A2) is a Protein Coding gene. Diseases associated with COX7A2 include Barrett's Adenocarcinoma and Esophagus Adenocarcinoma. Among its related pathways are Respiratory electron transport, ATP synthesis by chemiosmotic coupling, and heat production by uncoupling proteins. and AMPK Enzyme Complex Pathway. Gene Ontology (GO) annotations related to this gene include electron transfer activity and cytochrome-c oxidase activity. An important paralog of this gene is COX7A1. |
Product Overview | Mouse Anti-Dog COX7A2 Antibody is a mouse antibody against COX7A2. It can be used for COX7A2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Cytochrome c oxidase subunit 7A2, mitochondrial; Cytochrome c oxidase subunit VIIa-liver / heart; Cytochrome c oxidase subunit VIIa-L; COX7A2; COX7AL |
UniProt ID | Q9TR29 |
Protein Refseq | The length of the protein is 29 amino acids long. The sequence is show below: FENKVPEKQKLFQEDNGIPVVLKGGVADA. |
See other products for " COX7A2 "
MO-AB-53464W | Mouse Anti-Marmoset COX7A2 Antibody (MO-AB-53464W) |
MO-AB-24831R | Mouse Anti-Pig COX7A2 Antibody (MO-AB-24831R) |
MO-AB-18711W | Mouse Anti-Chimpanzee COX7A2 Antibody (MO-AB-18711W) |
MO-AB-10642R | Mouse Anti-Cattle COX7A2 Antibody (MO-AB-10642R) |
MO-AB-02606H | Mouse Anti-Frog cox7a2 Antibody (MO-AB-02606H) |
CBMOAB-39766FYA | Mouse Anti-Rhesus COX7A2 Antibody (CBMOAB-39766FYA) |
MO-AB-25018H | Mouse Anti-Rat Cox7a2 Antibody (MO-AB-25018H) |
For Research Use Only | Not For Clinical Use.
Online Inquiry