Mouse Anti-Rhesus COX7A2 Antibody (CBMOAB-39766FYA)


Cat: CBMOAB-39766FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO39766FYA
SpecificityThis antibody binds to Rhesus COX7A2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCOX7A2 (Cytochrome C Oxidase Subunit 7A2) is a Protein Coding gene. Diseases associated with COX7A2 include Barrett's Adenocarcinoma and Esophagus Adenocarcinoma. Among its related pathways are Respiratory electron transport, ATP synthesis by chemiosmotic coupling, and heat production by uncoupling proteins. and AMPK Enzyme Complex Pathway. Gene Ontology (GO) annotations related to this gene include electron transfer activity and cytochrome-c oxidase activity. An important paralog of this gene is COX7A1.
Product OverviewMouse Anti-Rhesus COX7A2 Antibody is a mouse antibody against COX7A2. It can be used for COX7A2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCytochrome c oxidase subunit 7A2, mitochondrial; COX7A2
UniProt IDH9Z5D2
Protein RefseqThe length of the protein is 115 amino acids long.
The sequence is show below: MLTQVSEVVPVPAWPFSLLVLSCGGCWSVTAKMLRNLLALRQIGQRTISTTSRRHLQNKVPEKQKLFQEDDGIPLYLKGGIADVLLYRATMVLGVGGTAYALYQLAVAAFPKKQE.
For Research Use Only | Not For Clinical Use.
Online Inquiry