Mouse Anti-Dog CTSK Antibody (MO-AB-29943W)


Cat: MO-AB-29943W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityDog (Canis lupus familiaris)
CloneMO29943W
SpecificityThis antibody binds to Dog CTSK.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationLysosome; Extracellular region or secreted; Plasma membrane; Nucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCTSK (Cathepsin K) is a Protein Coding gene. Diseases associated with CTSK include Pycnodysostosis and Endosteal Hyperostosis, Autosomal Dominant. Among its related pathways are RANK Signaling in Osteoclasts and Innate Immune System. Gene Ontology (GO) annotations related to this gene include cysteine-type endopeptidase activity and collagen binding. An important paralog of this gene is CTSS.
Product OverviewMouse Anti-Dog CTSK Antibody is a mouse antibody against CTSK. It can be used for CTSK detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCathepsin K; CTSK
UniProt IDG1K2A7
Protein RefseqThe length of the protein is 333 amino acids long.
The sequence is show below: FPRMWGLEVLLLLPMASFALYPEEILDTQWDLWKKTYRKQYNSKVDELSRRLIWEKNLKHISIHNLEASLGVHTYELAMNHLGDMTSEEVVQKMTGLKVPPSHSRSNDTLYIPDWESRAPDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQDESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPISVAIDASLTSFQFYSKGVYYDENCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM.
For Research Use Only | Not For Clinical Use.
Online Inquiry