Mouse Anti-Pig CTSK Antibody (MO-AB-24976R)
Cat: MO-AB-24976R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Pig (Sus scrofa) |
Clone | MO24976R |
Specificity | This antibody binds to Pig CTSK. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | CTSK (Cathepsin K) is a Protein Coding gene. Diseases associated with CTSK include Pycnodysostosis and Endosteal Hyperostosis, Autosomal Dominant. Among its related pathways are RANK Signaling in Osteoclasts and Innate Immune System. Gene Ontology (GO) annotations related to this gene include cysteine-type endopeptidase activity and collagen binding. An important paralog of this gene is CTSS. |
Product Overview | This product is a mouse antibody against CTSK. It can be used for CTSK detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Cathepsin K, Fragment; CTSK |
UniProt ID | Q0Q4G9 |
Protein Refseq | The length of the protein is 71 amino acids long. The sequence is show below: CTTPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDENCNSDNLNHAVLAV. |
See other products for " CTSK "
MO-AB-10932R | Mouse Anti-Cattle CTSK Antibody (MO-AB-10932R) |
MO-AB-29943W | Mouse Anti-Dog CTSK Antibody (MO-AB-29943W) |
MO-AB-26494W | Mouse Anti-Chimpanzee CTSK Antibody (MO-AB-26494W) |
MOFY-0722-FY435 | Rabbit Anti-CTSK Antibody (MOFY-0722-FY435) |
MOFY-0722-FY437 | FITC conjugated antibody to CTSK Antibody (MOFY-0722-FY437) |
MO-AB-07743Y | Mouse Anti-Rabbit CTSK Antibody (MO-AB-07743Y) |
MOFY-0722-FY172 | Rabbit Anti-CTSK Antibody (MOFY-0722-FY172) |
MO-AB-53723W | Mouse Anti-Marmoset CTSK Antibody (MO-AB-53723W) |
MO-AB-02742H | Mouse Anti-Frog ctsk Antibody (MO-AB-02742H) |
CBMOAB-40096FYA | Mouse Anti-Rhesus CTSK Antibody (CBMOAB-40096FYA) |
For Research Use Only | Not For Clinical Use.
Online Inquiry