Mouse Anti-Rhesus CTSK Antibody (CBMOAB-40096FYA)


Cat: CBMOAB-40096FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO40096FYA
SpecificityThis antibody binds to Rhesus CTSK.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCTSK (Cathepsin K) is a Protein Coding gene. Diseases associated with CTSK include Pycnodysostosis and Endosteal Hyperostosis, Autosomal Dominant. Among its related pathways are RANK Signaling in Osteoclasts and Innate Immune System. Gene Ontology (GO) annotations related to this gene include cysteine-type endopeptidase activity and collagen binding. An important paralog of this gene is CTSS.
Product OverviewMouse Anti-Rhesus CTSK Antibody is a mouse antibody against CTSK. It can be used for CTSK detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCathepsin K; CTSK
UniProt IDF7BLU2
Protein RefseqThe length of the protein is 258 amino acids long.
The sequence is show below: MHKENEEIENVSENRKHCHIFPCPLLTRSGKVPEFRQEREKCLEEMIRKQNLDGNLSFVMWGLKVLLLPVMSFALYPEEILDTHWELWKKTHRKQYNSKVDEISRRLIWEKNLKYISIHNLEASLGVHTYELAMNHLGDMTNEEVVQKMTGLKVPASHSRSNDTLYIPDWEGRAPDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSED.
See other products for " CTSK "
MOFY-0722-FY437FITC conjugated antibody to CTSK Antibody (MOFY-0722-FY437)
MO-AB-24976RMouse Anti-Pig CTSK Antibody (MO-AB-24976R)
MO-AB-02742HMouse Anti-Frog ctsk Antibody (MO-AB-02742H)
MO-AB-29943WMouse Anti-Dog CTSK Antibody (MO-AB-29943W)
MOFY-0722-FY45Mouse Anti-CTSK Antibody (MOFY-0722-FY45)
MO-AB-07743YMouse Anti-Rabbit CTSK Antibody (MO-AB-07743Y)
MO-AB-53723WMouse Anti-Marmoset CTSK Antibody (MO-AB-53723W)
MOFY-0722-FY435Rabbit Anti-CTSK Antibody (MOFY-0722-FY435)
MO-AB-26494WMouse Anti-Chimpanzee CTSK Antibody (MO-AB-26494W)
CBMOAB-72218FYAMouse Anti-Zebrafish ctsk Antibody (CBMOAB-72218FYA)
For Research Use Only | Not For Clinical Use.
Online Inquiry