Mouse Anti-Dog FBN1 Antibody (MO-AB-30750W)
Cat: MO-AB-30750W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Dog (Canis lupus familiaris) |
Clone | MO30750W |
Specificity | This antibody binds to Dog FBN1. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes a member of the fibrillin family of proteins. The encoded preproprotein is proteolytically processed to generate two proteins including the extracellular matrix component fibrillin-1 and the protein hormone asprosin. Fibrillin-1 is an extracellular matrix glycoprotein that serves as a structural component of calcium-binding microfibrils. These microfibrils provide force-bearing structural support in elastic and nonelastic connective tissue throughout the body. Asprosin, secreted by white adipose tissue, has been shown to regulate glucose homeostasis. Mutations in this gene are associated with Marfan syndrome and the related MASS phenotype, as well as ectopia lentis syndrome, Weill-Marchesani syndrome, Shprintzen-Goldberg syndrome and neonatal progeroid syndrome. |
Product Overview | Mouse Anti-Dog FBN1 Antibody is a mouse antibody against FBN1. It can be used for FBN1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Fibrillin 1; FBN1 |
UniProt ID | O18888 |
Protein Refseq | The length of the protein is 31 amino acids long. The sequence is show below: EGYESGFMMMKNCMDIDVCQRDPLLCRGGVC. |
See other products for " FBN1 "
MOFY-0522-FY82 | Mouse Anti-FBN1 Antibody (MOFY-0522-FY82) |
CBMOAB-42635FYA | Mouse Anti-Rhesus FBN1 Antibody (CBMOAB-42635FYA) |
CBMOAB-76160FYA | Mouse Anti-Zebrafish fbn1 Antibody (CBMOAB-76160FYA) |
CBMOAB-03534HCB | Mouse Anti-C. elegans FBN1 Antibody (CBMOAB-03534HCB) |
MO-AB-25786R | Mouse Anti-Pig FBN1 Antibody (MO-AB-25786R) |
MO-AB-12396R | Mouse Anti-Cattle FBN1 Antibody (MO-AB-12396R) |
MO-AB-55285W | Mouse Anti-Marmoset FBN1 Antibody (MO-AB-55285W) |
MO-AB-11354Y | Mouse Anti-O. mykiss FBN1 Antibody (MO-AB-11354Y) |
MO-AB-01861Y | Mouse Anti-Chicken Fbn1 Antibody (MO-AB-01861Y) |
For Research Use Only | Not For Clinical Use.
Online Inquiry