Mouse Anti-Dog GATA6 Antibody (MO-AB-30908W)


Cat: MO-AB-30908W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityDog (Canis lupus familiaris)
CloneMO30908W
SpecificityThis antibody binds to Dog GATA6.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene is a member of a small family of zinc finger transcription factors that play an important role in the regulation of cellular differentiation and organogenesis during vertebrate development. This gene is expressed during early embryogenesis and localizes to endo- and mesodermally derived cells during later embryogenesis and thereby plays an important role in gut, lung, and heart development. Mutations in this gene are associated with several congenital defects.
Product OverviewMouse Anti-Dog GATA6 Antibody is a mouse antibody against GATA6. It can be used for GATA6 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGATA binding protein 6; GATA6
UniProt IDQ6JDL1
Protein RefseqThe length of the protein is 36 amino acids long.
The sequence is show below: TTTTLCGRNGEGEPVCNACGLYMKLHGVPRPLAMKK.
For Research Use Only | Not For Clinical Use.
Online Inquiry