Mouse Anti-Dog GATA6 Antibody (MO-AB-30908W)
Cat: MO-AB-30908W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Dog (Canis lupus familiaris) |
Clone | MO30908W |
Specificity | This antibody binds to Dog GATA6. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Nucleus |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene is a member of a small family of zinc finger transcription factors that play an important role in the regulation of cellular differentiation and organogenesis during vertebrate development. This gene is expressed during early embryogenesis and localizes to endo- and mesodermally derived cells during later embryogenesis and thereby plays an important role in gut, lung, and heart development. Mutations in this gene are associated with several congenital defects. |
Product Overview | Mouse Anti-Dog GATA6 Antibody is a mouse antibody against GATA6. It can be used for GATA6 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | GATA binding protein 6; GATA6 |
UniProt ID | Q6JDL1 |
Protein Refseq | The length of the protein is 36 amino acids long. The sequence is show below: TTTTLCGRNGEGEPVCNACGLYMKLHGVPRPLAMKK. |
See other products for " gata6 "
CBMOAB-77592FYA | Mouse Anti-Zebrafish gata6 Antibody (CBMOAB-77592FYA) |
CBMOAB-33751FYC | Mouse Anti-Arabidopsis GATA6 Antibody (CBMOAB-33751FYC) |
MO-AB-26022R | Mouse Anti-Pig GATA6 Antibody (MO-AB-26022R) |
CBMOAB-43402FYA | Mouse Anti-Rhesus GATA6 Antibody (CBMOAB-43402FYA) |
MO-AB-15383Y | Mouse Anti-Sheep GATA6 Antibody (MO-AB-15383Y) |
For Research Use Only | Not For Clinical Use.
Online Inquiry