Mouse Anti-Pig GATA6 Antibody (MO-AB-26022R)


Cat: MO-AB-26022R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityPig (Sus scrofa)
CloneMO26022R
SpecificityThis antibody binds to Pig GATA6.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene is a member of a small family of zinc finger transcription factors that play an important role in the regulation of cellular differentiation and organogenesis during vertebrate development. This gene is expressed during early embryogenesis and localizes to endo- and mesodermally derived cells during later embryogenesis and thereby plays an important role in gut, lung, and heart development. Mutations in this gene are associated with several congenital defects.
Product OverviewThis product is a mouse antibody against GATA6. It can be used for GATA6 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGATA binding protein 6, Fragment; GATA6
UniProt IDB0JFA1
Protein RefseqThe length of the protein is 46 amino acids long.
The sequence is show below: RECVNCGSIQTPLWRRDGTGHYLCNACGLYSKMNGLSRPLIKPQKR.
For Research Use Only | Not For Clinical Use.
Online Inquiry