Mouse Anti-Dog p53 Antibody (MO-AB-32624W)


Cat: MO-AB-32624W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityDog (Canis lupus familiaris)
CloneMO32624W
SpecificityThis antibody binds to Dog p53.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionActs as a tumor suppressor in many tumor types; induces growth arrest or apoptosis depending on the physiological circumstances and cell type. Involved in cell cycle regulation as a trans-activator that acts to negatively regulate cell division by controlling a set of genes required for this process. One of the activated genes is an inhibitor of cyclin-dependent kinases. Apoptosis induction seems to be mediated either by stimulation of BAX and FAS antigen expression, or by repression of Bcl-2 expression.
Product OverviewMouse Anti-Dog p53 Antibody is a mouse antibody against p53. It can be used for p53 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCellular tumor antigen p53; p53
UniProt IDQ95326
Protein RefseqThe length of the protein is 285 amino acids long.
The sequence is show below: SSELCPAVDELLLPESVVNWLDEDSDDAPRMPATSAPTAPGPAPSWPLSSSVPSPKTYPGTYGFRLGFLHSGTAKSVTWTSPLLNKLFCQLAKTCPVQLWVSSPPPPNTCVRAMAIYKKSEFVTEVVRRCPHHERCSDSSDGLAPPQHLIRVEGNLRAKYLDDRNTFRHSVVVPYEPPEVGSDYTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNVLGRNSFEVRVCACPGRDRRTEEENFHKKGEPCPEPPPGSTKRTASQHQLLSPAKEEATRWRIFHPS.
See other products for " p53 "
MO-DKB-03647WRabbit Anti-p53 Antibody (Cat MO-DKB-03647W)
MOFAB-701WMouse Anti-D. melanogaster P53 Antibody (MOFAB-701W)
MO-NAB-00834WMouse Anti-Drosophila p53 Antibody (AA 282-386)
MOFY-0522-FY144Mouse Anti-p53 Antibody (MOFY-0522-FY144)
CBMOAB-27106FYAMouse Anti-D. melanogaster P53 Antibody (CBMOAB-27106FYA)
MO-AB-27704HMouse Anti-Rat p53 Antibody (MO-AB-27704H)
MOFY-0522-FY133Mouse Anti-p53 Antibody (MOFY-0522-FY133)
MO-AB-70208WMouse Anti-Silkworm p53 Antibody (MO-AB-70208W)
MO-AB-33576HMouse Anti-Nile tilapia p53 Antibody (MO-AB-33576H)
MO-NAB-00835WMouse Anti-Drosophila p53 Antibody (AA 282-386)
For Research Use Only | Not For Clinical Use.
Online Inquiry