Mouse Anti-Dog ppt1 Antibody (MO-AB-32877W)


Cat: MO-AB-32877W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityDog (Canis lupus familiaris)
CloneMO32877W
SpecificityThis antibody binds to Dog ppt1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationLysosome; Extracellular region or secreted; Cytosol; Golgi apparatus; Nucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionPhosphoenolpyruvate/phosphate translocator that transports phosphoenolpyruvate (PEP), 2-phosphoglycerate, 3-phosphoglycerate and dihydroxyacetone phosphate. Imports PEP to the chloroplast stroma as one substrate of the shikimate pathway, from which aromatic amino acids and a variety of secondary products derive. Required for correct leaf mesophyll cell development and expression of chlorophyll a/b binding protein 3 (CAB3).
Product OverviewMouse Anti-Dog ppt1 Antibody is a mouse antibody against ppt1. It can be used for ppt1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPalmitoyl-protein thioesterase 1; ppt1; PPT1
UniProt IDQ5JZR0
Protein RefseqThe length of the protein is 306 amino acids long.
The sequence is show below: MASPSCLWLLAVALLPGSGAARAPWRLDPAAPLPLVIWHGMGDSCCNPLSMGAIKKMVEEKIPGIYVLSLEIGKTLMEDVENSFFLNVNSQVTTVCQILAKDPKLHQGYNAMGFSQGGQFLRAVAQRCPSPPMINLISIGGQHQGVYGLPRCPGESSHICDLIRKTLNAGAYNKAIQERLVQAEYWHDPIKEDTYRNHSIFLADINQERGVNESYKRNLMALKKFVMVKFLNDSIVDPVDSEWFGFYRSGQAKETIPLQETALYTQDRLGLKEMDNAGQLVFLAVEGDHLQLSQEWFYAHIIPFLE.
For Research Use Only | Not For Clinical Use.
Online Inquiry