Mouse Anti-Rhesus PPT1 Antibody (CBMOAB-55251FYA)


Cat: CBMOAB-55251FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO55251FYA
SpecificityThis antibody binds to Rhesus PPT1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionPhosphoenolpyruvate/phosphate translocator that transports phosphoenolpyruvate (PEP), 2-phosphoglycerate, 3-phosphoglycerate and dihydroxyacetone phosphate. Imports PEP to the chloroplast stroma as one substrate of the shikimate pathway, from which aromatic amino acids and a variety of secondary products derive. Required for correct leaf mesophyll cell development and expression of chlorophyll a/b binding protein 3 (CAB3).
Product OverviewMouse Anti-Rhesus PPT1 Antibody is a mouse antibody against PPT1. It can be used for PPT1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPPT1
UniProt IDF7HMC2
Protein RefseqThe length of the protein is 279 amino acids long.
The sequence is show below: MASPSCLWLLAVALLPWTCAARALHHLDPPAPLPLVIWHGMGSHFVAQTGLKLLASSNPPASSYQSAGMIGDSCCNPLSMGAIKKMVEKKIPGIYVLSLEIGKTLMEDVENSFFLNVNSQVTTVCQTLAKDPKLQQGYNAMGFSQGGQFLRAVAQRCPSPPMINLISVGGQHQGVFGLPRCPGESSHICDFIRKTLNAGAYSKVVQERLVQAEYWHDPIKEDVYRNHSIFLADINQERGINESYKKNLMALKKFVMVKFLNDSIVDPVDSEWFGFYRSG.
See other products for " PPT1 "
MO-AB-13723WMouse Anti-Chimpanzee PPT1 Antibody (MO-AB-13723W)
MO-AB-12819YMouse Anti-O. mykiss PPT1 Antibody (MO-AB-12819Y)
CBMOAB-88797FYBMouse Anti-Rice PPT1 Antibody (CBMOAB-88797FYB)
CBMOAB-39266FYCMouse Anti-Arabidopsis PPT1 Antibody (CBMOAB-39266FYC)
MO-AB-06511HMouse Anti-Frog ppt1 Antibody (MO-AB-06511H)
CBMOAB-08581HCBMouse Anti-C. elegans PPT1 Antibody (CBMOAB-08581HCB)
CBMOAB-03080CRMouse Anti-Yeast PPT1 Antibody (CBMOAB-03080CR)
MO-AB-18407RMouse Anti-Cattle PPT1 Antibody (MO-AB-18407R)
CBMOAB-28166FYAMouse Anti-D. melanogaster Ppt1 Antibody (CBMOAB-28166FYA)
MO-AB-32877WMouse Anti-Dog ppt1 Antibody (MO-AB-32877W)
For Research Use Only | Not For Clinical Use.
Online Inquiry