Mouse Anti-Dog PTPN1 Antibody (MO-AB-32972W)


Cat: MO-AB-32972W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityDog (Canis lupus familiaris)
CloneMO32972W
SpecificityThis antibody binds to Dog PTPN1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Endosome; Plasma membrane; Endoplasmic reticulum

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is the founding member of the protein tyrosine phosphatase (PTP) family, which was isolated and identified based on its enzymatic activity and amino acid sequence. PTPs catalyze the hydrolysis of the phosphate monoesters specifically on tyrosine residues. Members of the PTP family share a highly conserved catalytic motif, which is essential for the catalytic activity.
Product OverviewMouse Anti-Dog PTPN1 Antibody is a mouse antibody against PTPN1. It can be used for PTPN1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTyrosine-protein phosphatase non-receptor type; EC 3.1.3.48; PTPN1
UniProt IDF1Q1Z8
Protein RefseqThe length of the protein is 427 amino acids long.
The sequence is show below: MEMEKEFEQIDKAGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLHQEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLKCAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLELENLASQETREILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSTEHGPIVVHCSAGIGRSGTFCLADTCLLLMDKRKDPSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQEQWKELSHEDLEPPPEHVPPPPRPPKRILEPHNGKCKEFFPNHQWVKDEPGEDKEACSIKEETRTPLNVPCSVESTSPDTEVRRRALGAGPAQGEPSPPKEEQDQALTPWKPFLVNMCMATVLTAGAYLCYRFLFSSST.
See other products for " PTPN1 "
MO-AB-16360WMouse Anti-Chimpanzee PTPN1 Antibody (MO-AB-16360W)
MO-AB-28679RMouse Anti-Pig PTPN1 Antibody (MO-AB-28679R)
MO-AB-35552WMouse Anti-Ferret PTPN1 Antibody (MO-AB-35552W)
MO-AB-08293WMouse Anti-Cat PTPN1 Antibody (MO-AB-08293W)
MO-NAB-00434WRabbit Anti-PTPN1 Antibody (AA 350-400)
CBMOAB-94523FYAMouse Anti-Zebrafish ptpn1 Antibody (CBMOAB-94523FYA)
CBMOAB-00292FYARabbit Anti-Zebrafish PTPN1 Antibody (CBMOAB-00292FYA)
MO-AB-62570WMouse Anti-Marmoset PTPN1 Antibody (MO-AB-62570W)
MO-AB-06720HMouse Anti-Frog ptpn1 Antibody (MO-AB-06720H)
MO-AB-18824RMouse Anti-Cattle PTPN1 Antibody (MO-AB-18824R)
For Research Use Only | Not For Clinical Use.
Online Inquiry