AibGenesis™ Mouse Anti-DPY19L2 Antibody (CBMOAB-41164FYA)


Cat: CBMOAB-41164FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-41164FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes) WB, ELISA MO41164FYA 100 µg
Inquiry
MO-AB-22666W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO22666W 100 µg
Inquiry

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes)
CloneMO41164FYA
SpecificityThis antibody binds to Rhesus DPY19L2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene belongs to the dpy-19 family. It is highly expressed in testis, and is required for sperm head elongation and acrosome formation during spermatogenesis. Mutations in this gene are associated with an infertility disorder, spermatogenic failure type 9 (SPGF9). (From NCBI)
Product OverviewMouse Anti-Rhesus DPY19L2 Antibody is a mouse antibody against DPY19L2. It can be used for DPY19L2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtein dpy-19 homolog 2; DPY19L2
UniProt IDH9F6J6
Protein RefseqThe length of the protein is 97 amino acids long.
The sequence is show below: EDADLRARTKIVYSTYSRKSAKEVRDKLLELHVNYCVLEEAWCVVRTKPGCSMLEIWDVEDPSNAANPPLCSVLLKDARPYFTTVFQNSVYRVLKVN.
For Research Use Only | Not For Clinical Use.
Online Inquiry