AibGenesis™ Mouse Anti-DREB2C Antibody (CBMOAB-22541FYB)


Cat: CBMOAB-22541FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-22541FYB Monoclonal Rice (Oryza), A. thaliana (Arabidopsis thaliana) WB, ELISA MO22541FYB 100 µg
Inquiry
CBMOAB-27857FYC Monoclonal A. thaliana (Arabidopsis thaliana) WB, ELISA MO27857FC 100 µg
Inquiry

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRice (Oryza), A. thaliana (Arabidopsis thaliana)
CloneMO22541FYB
SpecificityThis antibody binds to Rice DREB2C.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionProbable transcriptional activator that binds to the DNA sequence 5'-[AG]CCGAC-3' of the cis-acting dehydration-responsive element (DRE). (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Rice DREB2C Antibody is a mouse antibody against DREB2C. It can be used for DREB2C detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesDehydration-responsive element-binding protein 2C; OsDREB2C; DREB2C; AP22 ERF44; Os08g0565200 LOC_Os08g45110
UniProt IDQ84ZA1
Protein RefseqThe length of the protein is 230 amino acids long.
The sequence is show below: MEMDIGEGESCCGRRKQQQQQNISSSKSRKCCPLRRSRKGCMKGKGGPENQRCPFRGVRQRTWGKWVAEIREPNRGARLWLGTFNTALDAARAYDSAARALYGDCARLNLLLAAATAGAPPAAATPSVATPCSTNDDSNNSSSTTHQQQLTTMLQLDDDNYTLQPSSSDQEDFETYVTRLPKAEDFGLEGFQEVPLDVLDEAGGGISIWDLSICPADFMATAATTTAKSS.
For Research Use Only | Not For Clinical Use.
Online Inquiry