AibGenesis™ Mouse Anti-DUSP11 Antibody (CBMOAB-41308FYA)


Cat: CBMOAB-41308FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-41308FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Horse (Equus caballus), Zebrafish (Danio rerio) WB, ELISA MO41308FYA 100 µg
CBMOAB-74212FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO74212FYA 100 µg
MO-AB-11734R Monoclonal Cattle (Bos taurus) WB, ELISA MO11734R 100 µg
MO-AB-44501W Monoclonal Horse (Equus caballus) WB, ELISA MO44501W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Horse (Equus caballus), Zebrafish (Danio rerio)
CloneMO41308FYA
SpecificityThis antibody binds to Rhesus DUSP11.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted; Nucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a member of the dual specificity protein phosphatase subfamily. These phosphatases inactivate their target kinases by dephosphorylating both the phosphoserine/threonine and phosphotyrosine residues. They negatively regulate members of the mitogen-activated protein (MAP) kinase superfamily (MAPK/ERK, SAPK/JNK, p38), which is associated with cellular proliferation and differentiation. Different members of the family of dual specificity phosphatases show distinct substrate specificities for various MAP kinases, different tissue distribution and subcellular localization, and different modes of inducibility of their expression by extracellular stimuli. This gene product is localized to the nucleus and binds directly to RNA and splicing factors, and thus it is suggested to participate in nuclear mRNA metabolism. (From NCBI)
Product OverviewMouse Anti-Rhesus DUSP11 Antibody is a mouse antibody against DUSP11. It can be used for DUSP11 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRNA/RNP complex-1-interacting phosphatase; DUSP11
UniProt IDI0FVQ3
Protein RefseqThe length of the protein is 377 amino acids long.
The sequence is show below: MRNSETLERCVGGCRVSSGLGSYPGTEGAGLAVLAGLALGGRLLGTHMSQWHHPRSGWGRGRDFSGRSSAKKKGGNHIPERWKDYLPVGQRMPGTRFIAFKVPLQKSFEKKLAPEECFSPLDLFNKIREQNEELGLIIDLTYTQRYYKPEDLPESVPYLKIFTVGHQVPDDETIFKFKHAVNGFLKENKDNDKLIGVHCTHGLNRTGYLICRYLIDVEGMRPDDAIELFNRCRGHCLERQNYIEDLQNGPIRKNWNSSVPRSSFEDSAHLMQPVHTMNKPVKRGPRYNLHQIQGHSTRHFHTQTQNLQQSVRKFSQNPHVYQRGHLPPPGPPGEDCSRRRYSWNVKPNASLAAQDRRRWYPDNYSGLSYPAYWEWTQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry