AibGenesis™ Mouse Anti-DUSP13 Antibody (MO-AB-11737R)


Cat: MO-AB-11737R

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-11737R Monoclonal Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus) WB, ELISA MO11737R 100 µg
MO-AB-11880W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO11880W 100 µg
MO-AB-25500H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO25500C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus)
CloneMO11737R
SpecificityThis antibody binds to Cattle DUSP13.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Cattle DUSP13 Antibody is a mouse antibody against DUSP13. It can be used for DUSP13 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesDUSP13 protein; DUSP13
UniProt IDQ2T9T8
Protein RefseqThe length of the protein is 198 amino acids long.
The sequence is show below: MDSLQKQDLRRPKIHGSVRVSPYQPPTLASLQRLLWVRRAAMLNHINEVWPNLFLGDAYAARDKKKLTQLGITHVVNVAAGKFQVDTGAKFYRGMPLEYYGIEADDNPFFDLSVYYLPVARYIRSALSVPQGRVLVHCAMGVSRSATVVLAFLMICENMTLVEAIQTVQAHRDICPNSGFLRQLQVLDNRLGRETGRL.
For Research Use Only | Not For Clinical Use.
Online Inquiry