AibGenesis™ Mouse Anti-DUSP26 Antibody (MO-AB-11744R)


Cat: MO-AB-11744R

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-11744R Monoclonal Cattle (Bos taurus), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO11744R 100 µg
MO-AB-25511H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO25511C 100 µg
MO-AB-54589W Monoclonal Marmoset WB, ELISA MO54589W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Marmoset, Rat (Rattus norvegicus)
CloneMO11744R
SpecificityThis antibody binds to Cattle DUSP26.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationGolgi apparatus; Nucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the tyrosine phosphatase family of proteins and exhibits dual specificity by dephosphorylating tyrosine as well as serine and threonine residues. This gene has been described as both a tumor suppressor and an oncogene depending on the cellular context. This protein may regulate neuronal proliferation and has been implicated in the progression of glioblastoma through its ability to dephosphorylate the p53 tumor suppressor. Alternative splicing results in multiple transcript variants. (From NCBI)
Product OverviewMouse Anti-Cattle DUSP26 Antibody is a mouse antibody against DUSP26. It can be used for DUSP26 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesDual specificity protein phosphatase 26; EC 3.1.3.16; EC 3.1.3.48; DUSP26
UniProt IDQ17QJ3
Protein RefseqThe length of the protein is 211 amino acids long.
The sequence is show below: MCPGNWLWASVTFMARFSRSGSRSPVRVRGALEEPPAVQHPFLNVFELERLLYTGKTACNHADEVWPGLYLGDQEIANNHRELRRLGITHVLNASHSRWRGTPEAYEGLGIRYLGVEAHDSPAFDMSVHFQAAADFIHRALSQPGGRILVHCAVGVSRSATLVLAYLMLYHRLTLVEAIKKVKDHRGIIPNRGFLRQLLALDRRLRQGLEA.
For Research Use Only | Not For Clinical Use.
Online Inquiry