AibGenesis™ Mouse Anti-DUT Antibody (MO-AB-54601W)


Cat: MO-AB-54601W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-54601W Monoclonal Marmoset, A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Rice (Oryza), Zebrafish (Danio rerio) WB, ELISA MO54601W 100 µg
CBMOAB-27933FYC Monoclonal A. thaliana (Arabidopsis thaliana) WB, ELISA MO27933FC 100 µg
CBMOAB-74250FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO74250FYA 100 µg
CBMOAB-22552FYB Monoclonal Rice (Oryza) WB, ELISA MO22552FYB 100 µg
MO-AB-01959W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO01959W 100 µg
MO-AB-25528W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO25528W 100 µg
MO-AB-11751R Monoclonal Cattle (Bos taurus) WB, ELISA MO11751R 100 µg
MO-AB-03132H Monoclonal Frog (Xenopus laevis) WB, ELISA MO03132C 100 µg
MO-AB-25515H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO25515C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityMarmoset, A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Rice (Oryza), Zebrafish (Danio rerio)
CloneMO54601W
SpecificityThis antibody binds to Marmoset DUT.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes an essential enzyme of nucleotide metabolism. The encoded protein forms a ubiquitous, homotetrameric enzyme that hydrolyzes dUTP to dUMP and pyrophosphate. This reaction serves two cellular purposes: providing a precursor (dUMP) for the synthesis of thymine nucleotides needed for DNA replication, and limiting intracellular pools of dUTP. Elevated levels of dUTP lead to increased incorporation of uracil into DNA, which induces extensive excision repair mediated by uracil glycosylase. This repair process, resulting in the removal and reincorporation of dUTP, is self-defeating and leads to DNA fragmentation and cell death. Alternative splicing of this gene leads to different isoforms that localize to either the mitochondrion or nucleus. A related pseudogene is located on chromosome 19. (From NCBI)
Product OverviewMouse Anti-Marmoset DUT Antibody is a mouse antibody against DUT. It can be used for DUT detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesDeoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial isoform 1; DUT
UniProt IDU3FNL2
Protein RefseqThe length of the protein is 249 amino acids long.
The sequence is show below: MTPICPRPALCYHFLPSLLRSAIQNATGARLRAEAAGLSEPGQPLGRAAQHGRPRPLSSAGRLSRGCRGASTVGGAGRACFLRLGDAWRSETPAVSPSKRARPAEEGVMQLRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKALVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTKRGSGGFGSTGKN.
See other products for " dut "
For Research Use Only | Not For Clinical Use.
Online Inquiry