AibGenesis™ Mouse Anti-DUT Antibody (MO-AB-54601W)
Cat: MO-AB-54601W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| MO-AB-54601W | Monoclonal | Marmoset, A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Rice (Oryza), Zebrafish (Danio rerio) | WB, ELISA | MO54601W | 100 µg | ||
| CBMOAB-27933FYC | Monoclonal | A. thaliana (Arabidopsis thaliana) | WB, ELISA | MO27933FC | 100 µg | ||
| CBMOAB-74250FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO74250FYA | 100 µg | ||
| CBMOAB-22552FYB | Monoclonal | Rice (Oryza) | WB, ELISA | MO22552FYB | 100 µg | ||
| MO-AB-01959W | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO01959W | 100 µg | ||
| MO-AB-25528W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO25528W | 100 µg | ||
| MO-AB-11751R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO11751R | 100 µg | ||
| MO-AB-03132H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO03132C | 100 µg | ||
| MO-AB-25515H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO25515C | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Marmoset, A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Rice (Oryza), Zebrafish (Danio rerio) |
| Clone | MO54601W |
| Specificity | This antibody binds to Marmoset DUT. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Nucleus |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes an essential enzyme of nucleotide metabolism. The encoded protein forms a ubiquitous, homotetrameric enzyme that hydrolyzes dUTP to dUMP and pyrophosphate. This reaction serves two cellular purposes: providing a precursor (dUMP) for the synthesis of thymine nucleotides needed for DNA replication, and limiting intracellular pools of dUTP. Elevated levels of dUTP lead to increased incorporation of uracil into DNA, which induces extensive excision repair mediated by uracil glycosylase. This repair process, resulting in the removal and reincorporation of dUTP, is self-defeating and leads to DNA fragmentation and cell death. Alternative splicing of this gene leads to different isoforms that localize to either the mitochondrion or nucleus. A related pseudogene is located on chromosome 19. (From NCBI) |
| Product Overview | Mouse Anti-Marmoset DUT Antibody is a mouse antibody against DUT. It can be used for DUT detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial isoform 1; DUT |
| UniProt ID | U3FNL2 |
| Protein Refseq | The length of the protein is 249 amino acids long. The sequence is show below: MTPICPRPALCYHFLPSLLRSAIQNATGARLRAEAAGLSEPGQPLGRAAQHGRPRPLSSAGRLSRGCRGASTVGGAGRACFLRLGDAWRSETPAVSPSKRARPAEEGVMQLRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKALVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTKRGSGGFGSTGKN. |
See other products for " dut "
| CBMOAB-0629YC | AibGenesis™ Mouse Anti-dut Antibody (CBMOAB-0629YC) |
For Research Use Only | Not For Clinical Use.
Online Inquiry