AibGenesis™ Mouse Anti-ebna1bp2 Antibody (CBMOAB-74359FYA)


Cat: CBMOAB-74359FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-74359FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Horse (Equus caballus), Rat (Rattus norvegicus) WB, ELISA MO74359FYA 100 µg
MO-AB-11789R Monoclonal Cattle (Bos taurus) WB, ELISA MO11789R 100 µg
MO-AB-25556H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO25556C 100 µg
MO-AB-26734W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO26734W 100 µg
MO-AB-44505W Monoclonal Horse (Equus caballus) WB, ELISA MO44505W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Horse (Equus caballus), Rat (Rattus norvegicus)
CloneMO74359FYA
SpecificityThis antibody binds to Zebrafish ebna1bp2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish ebna1bp2 Antibody is a mouse antibody against ebna1bp2. It can be used for ebna1bp2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesEBNA1 binding protein 2-like; ebna1bp2; ebna1bp2
UniProt IDQ6DRD0
Protein RefseqThe length of the protein is 308 amino acids long.
The sequence is show below: MIEIDEDPQLGLHFDEDDDELSDDELQEAFAKGLLKPGLNIPQDEQKKTINNVEGLNKCLAEFKKNLPWIERLDLTNPPAVNIIAKAEGRAQQPEGSKEINAEDDFQREMYFYRQAQATVLAALPKLQKFKIPTKRPDDYFAEMAKTDQHMQKIRKKLLLKQEVMEKSEKAKRLREQRKYGKKVQTEVIQNRQKQKKAMLSAVKKYQKGMTDKLDFLEGDQNQGQKGSSTKKQINKKNPNAKRKYKDKKFGFGGRKKGSKWNTKESHDDVSAFKAKMAHGKGGGKVGNRVKMNKRPGKEARRKMKARK.
For Research Use Only | Not For Clinical Use.
Online Inquiry