AibGenesis™ Mouse Anti-EDARADD Antibody (CBMOAB-41451FYA)


Cat: CBMOAB-41451FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-41451FYA Monoclonal Rhesus (Macaca mulatta), Chicken (Gallus gallus), Guinea pig (Cavia porcellus), Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO41451FYA 100 µg
CBMOAB-74422FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO74422FYA 100 µg
MO-AB-01684Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO01684Y 100 µg
MO-AB-01995W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO01995W 100 µg
MO-AB-25563H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO25563C 100 µg
MO-AB-41592W Monoclonal Guinea pig (Cavia porcellus) WB, ELISA MO41592W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chicken (Gallus gallus), Guinea pig (Cavia porcellus), Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO41451FYA
SpecificityThis antibody binds to Rhesus EDARADD.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus EDARADD Antibody is a mouse antibody against EDARADD. It can be used for EDARADD detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesEDARADD
UniProt IDF7HTH8
Protein RefseqThe length of the protein is 215 amino acids long.
The sequence is show below: MGLRKTKQMGRGTKAPGHQDDHMAQEPVEDTDPSTLSFNTSDKYPVQDTELPKAEECNTITLNCPPNSDMKNQGEENGFPDSTGDPLPEISKDNSCKENCTCSSCLLRAPTISDLLNDQDLLDVIRIKLDPCHPTVKNWRNFASKWGMSYDELCFLEQRPQSPTLEFLLRNSQRTVGQLMELCRLYHRADVEKVLRRWVDEEWPKRERGDPSRHF.
For Research Use Only | Not For Clinical Use.
Online Inquiry