AibGenesis™ Mouse Anti-EFCAB2 Antibody (CBMOAB-41492FYA)


Cat: CBMOAB-41492FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-41492FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO41492FYA 100 µg
CBMOAB-74526FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO74526FYA 100 µg
MO-AB-11367W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO11367W 100 µg
MO-AB-11851R Monoclonal Cattle (Bos taurus) WB, ELISA MO11851R 100 µg
MO-AB-25587H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO25587C 100 µg
MO-AB-54718W Monoclonal Marmoset WB, ELISA MO54718W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO41492FYA
SpecificityThis antibody binds to Rhesus EFCAB2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe gene encodes a protein that contains two EF-hand calcium-binding domains although its function has yet to be determined. Alternatively spliced transcripts have been observed. (From NCBI)
Product OverviewMouse Anti-Rhesus EFCAB2 Antibody is a mouse antibody against EFCAB2. It can be used for EFCAB2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesEFCAB2
UniProt IDF6R0Y9
Protein RefseqThe length of the protein is 188 amino acids long.
The sequence is show below: GYDSDEMRPLTLLIEHLMEGGRRDHHTITVLRGTRIIVAEFHKKIKEAFEVFDHESNNTVDVREIGTIIRSLGCCPTEGELHDLIAEVEEEEPTGYIRFEKFLPVMTEILLERRYRPIPEDVLLRAFEVLDSAKRGFLTKDELIKYMTEEGEPFSQEEMEEMLSAAIDPESNSIHYKDYITMMVIDEN.
For Research Use Only | Not For Clinical Use.
Online Inquiry