AibGenesis™ Mouse Anti-EFHC2 Antibody (CBMOAB-41513FYA)


Cat: CBMOAB-41513FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-41513FYA Monoclonal Rhesus (Macaca mulatta), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO41513FYA 100 µg
CBMOAB-74538FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO74538FYA 100 µg
MO-AB-54727W Monoclonal Marmoset WB, ELISA MO54727W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Marmoset, Zebrafish (Danio rerio)
CloneMO41513FYA
SpecificityThis antibody binds to Rhesus EFHC2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein which contains three DM10 domains and three calcium-binding EF-hand motifs. A related protein is encoded by a gene on chromosome 6. It has been suggested that both proteins are involved in the development of epilepsy (PMID: 15258581, 16112844) and that this gene may be associated with fear recognition in individuals with Turner syndrome. (From NCBI)
Product OverviewMouse Anti-Rhesus EFHC2 Antibody is a mouse antibody against EFHC2. It can be used for EFHC2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesEF-hand domain-containing family member C2; EFHC2
UniProt IDH9FHT7
Protein RefseqThe length of the protein is 201 amino acids long.
The sequence is show below: VMMLVSDEKPGIGGEPLLGQKIKPKCSIYPKGDGSDVPSWVAFDKQVLSFDAYLEEEVPDKSQTNYRIRYYKIYFYPEDDTIQVNEPEVKNSGLLQGTSIRRHRITLPPPDEDQFYTVYHFNVGTEVVFYGRTFKIYDCDAFTRNFLRKIGVKVNPPVPCPEDPYMKIRREVLEHVEPLRPYESLDTLKQFLQYHGKILCF.
For Research Use Only | Not For Clinical Use.
Online Inquiry