Rabbit Anti-EFNB1 (Center) Antibody (Cat MO-DKB-03471W)
Cat: MO-DKB-03471W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
MO-DKB-03471W | Polyclonal | Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Cattle (Bos taurus), Dog (Canis lupus familiaris), Horse (Equus caballus), Guinea pig (Cavia porcellus), Zebrafish (Danio rerio), Chicken (Gallus gallus), Primate, Frog (Xenopus) | WB | 100 µg | |||
CBMOAB-74558FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO74558FYA | 100 µg | ||
MO-AB-11867R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO11867R | 100 µg | ||
MO-DKB-03252W | Polyclonal | Human (Homo sapiens), Rat (Rattus norvegicus), Human (Homo sapiens), Mouse (Mus musculus), Cattle (Bos taurus), Dog (Canis lupus familiaris), Chicken (Gallus gallus), Primate, Zebrafish (Danio rerio) | WB | 100 µg | |||
MO-DKB-03383W | Polyclonal | Mouse (Mus musculus), Rat (Rattus norvegicus), Chicken (Gallus gallus), Human (Homo sapiens), Cattle (Bos taurus), Chicken (Gallus gallus), Frog (Xenopus), Zebrafish (Danio rerio) | WB, IF | 100 µg |
Specifications
Host species | Rabbit (Oryctolagus cuniculus) |
Species Reactivity | Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Cattle (Bos taurus), Dog (Canis lupus familiaris), Horse (Equus caballus), Guinea pig (Cavia porcellus), Zebrafish (Danio rerio), Chicken (Gallus gallus), Primate, Frog (Xenopus) |
Specificity | This antibody is binds to Human Ephrin-B1 [p Tyr331] and has cross reactivity with Mouse, Rat, Cattle, Dog, Horse, Guinea pig, Zebrafish Ephrin-B1 [p Tyr331]. |
Immunogen | A synthetic peptide targeting the middle region of human CHERP. Peptide sequence EQGIQDPIKGGDVRDKWDQYKGVGVALDDPYENYRRNKSYSFIARMKARD. The peptide sequence of the immunogen was taken from the region. |
Epitope | Center |
Format | Liquid or Lyophilized |
Buffer | PBS, 2% Sucrose |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purification | Affinity purified |
Application Information
Application | WB |
Application Notes | Western Blot: 1.0 ug/mL The optimal dilution should be determined by the end user. |
Target
Introduction | The protein encoded by this gene is a type I membrane protein and a ligand of Eph-related receptor tyrosine kinases. It may play a role in cell adhesion and function in the development or maintenance of the nervous system. (From NCBI) |
Product Overview | This product is a Rabbit antibody against the Ephrin-B1 [p Tyr331]. It can be used for Ephrin-B1 [p Tyr331] detection in Western Blot. |
Alternative Names | Efnb1; efnb |
UniProt ID | B0CM03 |
See other products for " EFNB1 "
CBMOAB-41523FYA | Mouse Anti-EFNB1 Antibody (CBMOAB-41523FYA) |
MO-AB-13407W | Mouse Anti-EFNB1 Antibody (MO-AB-13407W) |
MO-AB-54736W | Mouse Anti-EFNB1 Antibody (MO-AB-54736W) |
MO-AB-03209H | Mouse Anti-efnb1 Antibody (MO-AB-03209H) |
For Research Use Only | Not For Clinical Use.
Online Inquiry