AibGenesis™ Mouse Anti-Ehd2 Antibody (CBMOAB-22585FYB)


Cat: CBMOAB-22585FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-22585FYB Monoclonal Rice (Oryza), A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rhesus (Macaca mulatta), Rice WB, ELISA MO22585FYB 100 µg
Inquiry
CBMOAB-28158FYC Monoclonal A. thaliana (Arabidopsis thaliana) WB, ELISA MO28158FC 100 µg
Inquiry
CBMOAB-41555FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO41555FYA 100 µg
Inquiry
MO-AB-03224H Monoclonal Frog (Xenopus laevis) WB, ELISA MO03224C 100 µg
Inquiry
MO-AB-11886R Monoclonal Cattle (Bos taurus) WB, ELISA MO11886R 100 µg
Inquiry
MO-AB-17334W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO17334W 100 µg
Inquiry
MO-AB-54764W Monoclonal Marmoset WB, ELISA MO54764W 100 µg
Inquiry
MO-MMB-0369 Polyclonal Rice ELISA, WB 100 µg
Inquiry

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRice (Oryza), A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rhesus (Macaca mulatta), Rice
CloneMO22585FYB
SpecificityThis antibody binds to Rice Ehd2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the EH domain-containing protein family. These proteins are characterized by a C-terminal EF-hand domain, a nucleotide-binding consensus site at the N terminus and a bipartite nuclear localization signal. The encoded protein interacts with the actin cytoskeleton through an N-terminal domain and also binds to an EH domain-binding protein through the C-terminal EH domain. This interaction appears to connect clathrin-dependent endocytosis to actin, suggesting that this gene product participates in the endocytic pathway. (From NCBI)
Product OverviewMouse Anti-Rice Ehd2 Antibody is a mouse antibody against Ehd2. It can be used for Ehd2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCys2/His2-type zinc finger transcription factor; Early heading date 2; Ehd2; RID1
UniProt IDB1B534
Protein RefseqThe length of the protein is 475 amino acids long.
The sequence is show below: MLLSDLSSDQEATGSNSHGGGGGDRMVVGSHGAAHVVLSNLFLPPAAAAAATMLLPAAPVMVRPAAMAAAQEPRAKKKRSLPGNPDPEAEVIALSPRALVATNRFVCEVCNKGFQRDQNLQLHRRGHNLPWKLRHRAAAVSAVTTAAPAPRKRVYVCPEPTCVHHDPARALGDLTGIKKHFSRKHGEKRWRCERCGKRYAVHSDWKAHVKNCGTREYRCDCGILFSRKDSLLTHRAFCDALAEESARLLAAANNSSSITTTTCNNSNISSNNNNNNINSISNSNNLLITSSSSSPPLFLPFSTTPAENPNPNQLLFLQQHQAAHHQLLLPQFQQPPSSPPAYFDHLAFGGGGGVITGSSCNDDNSSIAGDVMVAAGGDSVSFGLTSEGSVTMHAGDVGRRRLTRDFLGVDHDAGEVDELELDELPADLSTTAAACQGCNFAAATTAACCATDFTTGSRQYLGRLPPVNETWSHNF.
For Research Use Only | Not For Clinical Use.
Online Inquiry