Mouse Anti-Elephant S100A11 Antibody (MO-AB-01310L)
Cat: MO-AB-01310L
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
| Size: | |
| Conjugate: | |
| Inquiry |
- Product Details
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Elephant (Loxodonta africana) |
| Clone | MO01310L |
| Specificity | This antibody binds to Elephant S100A11. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Nucleus; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in motility, invasion, and tubulin polymerization. Chromosomal rearrangements and altered expression of this gene have been implicated in tumor metastasis. |
| Product Overview | This product is a mouse antibody against S100A11. It can be used for S100A11 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | S100 Calcium Binding Protein A11; Metastatic Lymph Node Gene 70 Protein; Protein S100-C; Calgizzarin; MLN 70; MLN70; S100C |
| UniProt ID | G3UDW5 |
| Protein Refseq | The length of the protein is 92 amino acids long. The sequence is show below: SPTETERCIESLIAVFQKYAGQDGKNLTLSKREFLNFMNTELAAFTKNQKDPGVLDRMMKKLDLNSDGQLDFQEFLNLIGGLAQACHDSFMR. |
See other products for " S100A11 "
| MO-AB-46417W | Mouse Anti-Horse S100A11 Antibody (MO-AB-46417W) |
| MO-AB-28788H | Mouse Anti-Rat S100a11 Antibody (MO-AB-28788H) |
| MO-AB-33214W | Mouse Anti-Dog S100A11 Antibody (MO-AB-33214W) |
| MO-AB-23698H | Mouse Anti-Mallard S100A11 Antibody (MO-AB-23698H) |
| MO-AB-42504W | Mouse Anti-Guinea pig S100A11 Antibody (MO-AB-42504W) |
| MO-AB-07389H | Mouse Anti-Frog s100a11 Antibody (MO-AB-07389H) |
| MO-AB-19686R | Mouse Anti-Cattle S100A11 Antibody (MO-AB-19686R) |
| MO-AB-17547Y | Mouse Anti-Sheep S100A11 Antibody (MO-AB-17547Y) |
| MO-AB-63746W | Mouse Anti-Marmoset S100A11 Antibody (MO-AB-63746W) |
| MO-AB-12436W | Mouse Anti-Chimpanzee S100A11 Antibody (MO-AB-12436W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry