Mouse Anti-Rat S100a11 Antibody (MO-AB-28788H)


Cat: MO-AB-28788H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRat (Rattus norvegicus)
CloneMO28788C
SpecificityThis antibody binds to Rat S100a11.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Nucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in motility, invasion, and tubulin polymerization. Chromosomal rearrangements and altered expression of this gene have been implicated in tumor metastasis.
Product OverviewThis product is a mouse antibody against S100a11. It can be used for S100a11 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtein S100-A11; Calgizzarin; S100 calcium-binding protein A11; S100a11
UniProt IDQ6B345
Protein RefseqThe length of the protein is 98 amino acids long.
The sequence is show below: MPTETERCIESLIAVFQKYSGKDGNSCHLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDLNSDGQLDFQEFLNLIGGLAIACHESFLQTSQKRI.
For Research Use Only | Not For Clinical Use.
Online Inquiry