AibGenesis™ Mouse Anti-ELSPBP1 Antibody (MO-AB-25578R)


Cat: MO-AB-25578R

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-25578R Monoclonal Pig (Sus scrofa), Dog (Canis lupus familiaris) WB, ELISA MO25578R 100 µg
Inquiry
MO-AB-30692W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO30692W 100 µg
Inquiry

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityPig (Sus scrofa), Dog (Canis lupus familiaris)
CloneMO25578R
SpecificityThis antibody binds to Pig ELSPBP1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene belongs to the sperm-coating protein family of epididymal origin. This protein and its canine homolog are the first known examples of proteins with four tandemly arranged fibronectin type 2 (Fn2) domains in the Fn2-module protein family. (From NCBI)
Product OverviewThis product is a mouse antibody against ELSPBP1. It can be used for ELSPBP1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesEpididymal sperm-binding protein 1; ELSPBP1
UniProt IDF1RLA2
Protein RefseqThe length of the protein is 223 amino acids long.
The sequence is show below: MNRWSSYLLGCTAFILYSYETSGDTKDSCVFPFNYKGFTYFSCTRTNSLSPWCATRAVYDGQWKYCLIEDYPRCVFPFIYRGRSHRNCIVEGSFFGKLWCSVTSSFDEKQQWKYCEINEYGGNSFSKPCIFPSKYRNHIISECLEDESNKLWCPTTENMDMDGKWSLCADTRISSLVPGFPCHFPFNYKNKNYFNCTTKGSKENLLWCATSYNYDQDHTWVYC.
For Research Use Only | Not For Clinical Use.
Online Inquiry