AibGenesis™ Mouse Anti-EMCN Antibody (MO-AB-12007R)


Cat: MO-AB-12007R

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-12007R Monoclonal Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO12007R 100 µg
MO-AB-16291W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO16291W 100 µg
MO-AB-25642H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO25642C 100 µg
MO-AB-54914W Monoclonal Marmoset WB, ELISA MO54914W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus)
CloneMO12007R
SpecificityThis antibody binds to Cattle EMCN.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Cattle EMCN Antibody is a mouse antibody against EMCN. It can be used for EMCN detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesEndomucin; EMCN
UniProt IDQ0VCS5
Protein RefseqThe length of the protein is 250 amino acids long.
The sequence is show below: MKLLQGTIFCLLLSSISSNDQIADTSATTTPLSTTSEINTTPPTRDTRTSPNGTSSKEAAQMPHLLTLSPVTPNTKGDGASTESIMETKLSTTEATVMSQSLSNAVSTSQSSDSKTETQSSIKATETPVNTSPPEASSFRTATLSSISVTTAENISPSQVGLENAKNASASTTSPSYSSIILPIVIALIVITLSVFVLVGLYRMCWKTDPGTQENGNEQPQSDKESVKLLTVKTISHESGEHSAQGKTKN.
For Research Use Only | Not For Clinical Use.
Online Inquiry